Conserved Protein Domain Family
PX_PLD

?
cd06895: PX_PLD 
The phosphoinositide binding Phox Homology domain of Phospholipase D
The PX domain is a phosphoinositide (PI) binding module present in many proteins with diverse functions such as cell signaling, vesicular trafficking, protein sorting, and lipid modification, among others. Phospholipase D (PLD) catalyzes the hydrolysis of the phosphodiester bond of phosphatidylcholine to generate membrane-bound phosphatidic acid and choline. Members of this subfamily contain PX and Pleckstrin Homology (PH) domains in addition to the catalytic domain. PLD activity has been detected in viruses, bacteria, yeast, plants, and mammals, but the PX domain is not present in PLDs from viruses and bacteria. PLDs are implicated in many cellular functions like signaling, cytoskeletal reorganization, vesicular transport, stress responses, and the control of differentiation, proliferation, and survival. Vertebrates contain two PLD isozymes, PLD1 and PLD2. PLD1 is located mainly in intracellular membranes while PLD2 is associated with plasma membranes. The PX domain is involved in targeting of proteins to PI-enriched membranes, and may also be involved in protein-protein interaction.
Statistics
?
PSSM-Id: 132805
View PSSM: cd06895
Aligned: 16 rows
Threshold Bit Score: 142.906
Threshold Setting Gi: 170575336
Created: 10-Jul-2008
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
 
phosphoinosit..
Feature 1:phosphoinositide binding site [chemical binding site]
Evidence:
  • Comment:A majority of PX domain containing proteins binds phosphatidylinositol-3-phosphate (PI3P) at this site. In some cases, other phosphoinositides, such as PI4P or PI(3,4)P2, are the preferred substrates.
  • Comment:based on the structures of phosphatidylinositol-3-phosphate bound to other members of this superfamily
  • Comment:Two basic residues are key in binding with phosphoinositides: one forms hydrogen bonds with the 3-phosphate of PI(3)P and another forms hydrogen bonds with the 4-and 5-hydroxyl groups of PI(3)P.

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                   ###                                   
gi 19861153    78 GCPVKAQVLEVERFTst-srMPSVNLYTIELTHGEFTWQVKRKFKHFQEFHRELLKykAFIRipiptkrhtf-------- 148
gi 8247945     62 GVPVIAQVVGTERYTsg-skVGTCTLYSVRLTHGDFTWTTKKKFRHFQELHRDLQRhkVLMSllnlarfaaa-------- 132
gi 169154664   28 EVPILVQVTEVERFTss--rVLNPNLYTVELSHGDFKWKIKRRFKHFQALHQELLKfrALLKiplpsrihsvnr------ 99
gi 194739329   78 GTAFSVEVTDVERFGss-rrTEKTCRYTVRISHGPFEWAIKRRYKHFHQLHQELQRyrALLHlqrparrlkehrls---- 152
gi 198429888   93 KTPLSVNITCVKHDVty-rhPLNPNLYTIELAHGQFTWTIYRRYKHFIELHEKLWTyrASLKiplpskkhrrr------- 164
gi 219464646   70 GEPIDVKIIDVERSYrr--kPLNPNLYTINLQHGEHNWTIKRRYKHFIQLHEAILLfkASLHvpvptarqre-------- 139
gi 194739327   66 NTEIHVRVTENVRVGkq--kQGGNSPYKVEFTHGEFVWNIRCSFKQVQALHNALRQyrTLLHlplltrnfqd-------- 135
gi 170575336   58 GVPVKARITDVKRDEkfglhLINAYLYVIELEHGPFRWTVVKQNKDFAVLAARLLThrAAERirapvrraqevlddales 137
gi 168032769   18 TELPTARVVEVSRSErndqsLAFQLVYTIELQYKQFTWRLERKATQLLFLHLALKKr-ALLEdiqerqeqikewahnlgf 96
gi 6714447     42 DELPKAAIVSVSRPDtt-dfSPLLLSYTLELQYKQFKWTLQKKASQVLYLHFALKKr-LIIEelhdkqeqvrewlhslgi 119
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                         
gi 19861153       --------------------------------------------------------------------------------
gi 8247945        --------------------------------------------------------------------------------
gi 169154664  100 ------------------------------------------------------------------------------rs 101
gi 194739329  153 ----------------------------------------------------------------------------mrre 156
gi 198429888  165 ------------------------------------------------------------------------------rl 166
gi 219464646      --------------------------------------------------------------------------------
gi 194739327      --------------------------------------------------------------------------------
gi 170575336  138 igvdiipdhrndcpyrktsdhqkihnlnrsddrdnihqsgttkneinteqqsvptdftrtasvripnvspxtrenilkqr 217
gi 168032769   97 gdeh---------------------------------------------------------------pststttnlrshs 113
gi 6714447    120 fdmqgs-----------------------------------------------------------vvqddeepddgalpl 140
                         170       180       190       200       210       220
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*...
Feature 1                         ##                   #                              
gi 19861153   149 rrqnvkeepREMPSLPRSSEnai-------qeEQFFGRRKQLEDYLTKILKMpMYRNYHATTEFLDVS 209
gi 8247945    133 hspareaanENIPSLPRGGSeg--------saRHTASKQKYLENYLNRLLTMsFYRNYHAMTEFLEVS 192
gi 169154664  102 fkgrkrfhgERIPTLPRRPDalv-------reEQLISRKMQLEDYLRNVLKKpLYRTHPATLEFLEVS 162
gi 194739329  157 rkvnaedktSRPPQLPARIDssqqdntpanveTNLSSRKKHVENYLQTLLRIpVYRDHPSTLEFLEVS 224
gi 198429888  167 tthgmpkkeSKMPQFPKTPEilv-------ssEDLDKRKDQLCLYLQAMLKSrMYRKHPATFKFTGVA 227
gi 219464646  140 krksvkgqpRKLPKLPKTPDali-------tgARLNRRMEQLEIYLQRLVNIrTFRNLEPTLKFLEVS 200
gi 194739327  136 ripksasgnRRIPELPNELLtpesed-ldleaGPMSSHKRQIENYLSSILKIsIYRNHQTTLDVLEVS 202
gi 170575336  218 nvrlseikrHQLPSLGFVPDa----------vIDPNERRQRLEKWLQAVLHIpVNRNHHETAEFLEVS 275
gi 168032769  114 shherhssqGDIPSSAALPVirpai---grlpDISPRATAAMQNYLNHFLESlDIVNTVEVCKFLEVS 178
gi 6714447    141 hytedsiknRNVPSRAALPIirpti---grseTVVDRGRTAMQGYLSLFLGNlDIVNSKEVCKFLEVS 205

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap