1OVL,1PDU,1YJE,1OVL


Conserved Protein Domain Family
NR_LBD_Nurr1_like

?
cd06945: NR_LBD_Nurr1_like 
Click on image for an interactive view with Cn3D
The ligand binding domain of Nurr1 and related nuclear receptor proteins, members of nuclear receptor superfamily
The ligand binding domain of nuclear receptor Nurr1_like: This family of nuclear receptors, including Nurr1, Nerve growth factor-induced-B (NGFI-B) and DHR38 are involved in the embryo development. Nurr1 is a transcription factor that is expressed in the embryonic ventral midbrain and is critical for the development of dopamine (DA) neurons. Structural studies have shown that the ligand binding pocket of Nurr1 is filled by bulky hydrophobic residues, making it unable to bind to ligands. Therefore, it belongs to the class of orphan receptors. However, Nurr1 forms heterodimers with RXR and can promote signaling via its partner, RXR. NGFI-B is an early immediate gene product of embryo development that is rapidly produced in response to a variety of cellular signals including nerve growth factor. It is involved in T-cell-mediated apoptosis, as well as neuronal differentiation and function. NGFI-B regulates transcription by binding to a specific DNA target upstream of its target genes and regulating the rate of tr anscriptional initiation. Another group of receptor in this family is DHR38. DHR38 is the Drosophila homolog to the vertebrate NGFI-B-type orphan receptor. It interacts with the USP component of the ecdysone receptor complex, suggesting that DHR38 might modulate ecdysone-triggered signals in the fly, in addition to the ECR/USP pathway. Nurr1_like proteins exhibit a modular structure that is characteristic for nuclear receptors; they have a central well conserved DNA binding domain (DBD), a variable N-terminal domain, a non-conserved hinge and a C-terminal ligand binding domain (LBD).
Statistics
?
PSSM-Id: 132743
View PSSM: cd06945
Aligned: 10 rows
Threshold Bit Score: 271.967
Threshold Setting Gi: 74938425
Created: 19-Nov-2008
Updated: 17-Jan-2013
Structure
?
Program:
Drawing:
Aligned Rows:
 
heterodimerputative
Conserved site includes 9 residues -Click on image for an interactive view with Cn3D
Feature 1:heterodimer interface [polypeptide binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                  #  #  ##                                                               
1OVL_A         34 PVSLISALVRAHVDSNPam----tSLDYSRFQanpdyqm-------------------------sgddtqHIQQFYDLLT 84
1PDU_A         12 AISLITALVRSHVDTTPdp----sCLDYSHYEeqsm------------------------------seadKVQQFYQLLT 57
1YJE_A         27 PTNLLTSLIRAHLDSGPnt----aKLDYSKFQelvlprf-------------------------gkedagDVQQFYDLLS 77
gi 47060281   354 PLSLLNALVRAYSQSTPr------ELDYSQVTdavepv--------------------------glsesqQIQMFYRVLT 401
gi 82252975   388 PLSLLSALLRAYSHSTPr------DLDYSQVInfrppdlrfclgfraaaciclspqfsaadpptstpdveQIQLFYRLLT 461
gi 118343914  814 PVSFITSLVRAHVDTNPai----sNTDTSKYRppgiapct-----------------------pplrvvdEAINFYELLS 866
gi 74938425   108 SSELVTQLIQARPDAIPkkrpdyvDLGFVDICpl-----------------------------------nPVEIIMDLAL 152
gi 16797872   197 DCTDKSLAPRSADAPSSre---etMAFIAKIQenvtlvpeipgh---------------slesdekpgskDVNKLMALAY 258
1OVL_B         34 PVSLISALVRAHVDSNPam----tSLDYSRFQanpdyqm-------------------------sgddtqHIQQFYDLLT 84
gi 115623739  486 PVSLITALVRAHVDASPak----aNRDYSQFRlpgdvis-------------------------pppdneQLQIFYDNFC 536
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                         
1OVL_A         85 GSMEIIRGWAEKIPGFaDLPKADQDLLFESAFLELFVLRLAYRSNPVEGKLIFCNGVVLHRLQCVRGFGEWIDSIVEFSS 164
1PDU_A         58 SSVDVIKQFAEKIPGYfDLLPEDQELLFQSASLELFVLRLAYRARIDDTKLIFCNGTVLHRTQCLRSFGEWLNDIMEFSR 137
1YJE_A         78 GSLDVIRKWAEKIPGFiELSPGDQDLLLESAFLELFILRLAYRSKPGEGKLIFCSGLVLHRLQCARGFGDWIDNILAFSR 157
gi 47060281   402 GSMEVTRCWAERLPGFsELHHDDQNMLIDSAFLELFVLRLANRSLLVDEKFVFCTGLVLHRLQCLRGFGEWLDSIRDFSA 481
gi 82252975   462 ISMETTRCWADRLPGFsELQRDDQNLLVDSAFLELFVLRLAYRSMLSEDKLVFCNGLVLHRFQCLRGFGEWLDSIRDFST 541
gi 118343914  867 ACQAVIRQWAEKIPGFcNLCQEDQTNLVENSFLDIFVLRLAYRSEIQEGKLVFCNGLALHRDQLYGSFGEWIDSILSFAC 946
gi 74938425   153 QEVDLMVAWTYKVPGFkELDREDQASLLSSALLELFVLRVCQRSSPHQGSVLVAKDILLNPEHSFNMVLEQWSSQLACFS 232
gi 16797872   259 TELQFVIQWAKGVPGFkDLHLEDQVCLLKACFMDLNVFRLAYRSVACDPMSVRFSQNTILEKEEVVALGWAEDLVDATLE 338
1OVL_B         85 GSXEIIRGWAEKIPGFaDLPKADQDLLFESAFLELFVLRLAYRSNPVEGKLIFCNGVVLHRLQCVRGFGEWIDSIVEFSS 164
gi 115623739  537 SSIDVIRSWAERIPGFsDLCREDQDLLFQSSCLELFVLKMAYRVNPEDPYVVFCNGNVLHNQQCERGFGEWLDDIRAFSK 616
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                  # ###                                    #                             
1OVL_A        165 NLQn----XNIDISAFSCIAALAXVTERHGLKEPKRVEELQNKIVNCLKDHVtfnngg----lnrpnyLSKLLGKLPELR 236
1PDU_A        138 SLHn----LEIDISAFACLCALTLITERHGLREPKKVEQLQMKIIGSLRDHVtynaea----qkkqhyFSRLLGKLPELR 209
1YJE_A        158 SLHs----LGVDVPAFACLSALVLITDRHGLQDPRRVEELQNRIASCLKEHMaavagd----pqpascLSRLLGKLPELR 229
gi 47060281   482 HLQe---lNLDMPAFSCLCALVLLTEQCPGLKEPKKVEELQSKLICCLRDHLnsinaggvastgkappPVGAVLGLRAEL 558
gi 82252975   542 HLQs---lNLDASAFACLAALVLLTEQVPGLKDSKRVEELQNKVICCLRDHLscgpsss---sskappPLNRVLGLRAEL 615
gi 118343914  947 SLAd----MNVDISSFSCLLGLLLFREPRGVREPKKVEELLGLCIESLKEHVtkssvt----adrpnyFAKLLAILPELN 1018
gi 74938425   233 YKLqs-lqLDMAEFACVNAIMLFEQESSSGLKNREMVDFILNRSLDALRDYIkcsyp------dkpsrFAHILLRLPTLR 305
gi 16797872   339 FSDklrslNLDQNEFACLSALVLLSPDTPELKNRAKVEELQAKVNSILRDYAaslyp------lkpnrLGKLLLCLPTLR 412
1OVL_B        165 NLQn----XNIDISAFSCIAALAXVTERHGLKEPKRVEELQNKIVNCLKDHVtfnngg----lnrpnyLSKLLGKLPELR 236
gi 115623739  617 VLSs----LEIDISSFACLSSLVLITERHGLKEPEKVSQLQNRIISCLNDHVtyntca----qtranfLSRMLMQLPELR 688
                         250       260       270
                  ....*....|....*....|....*....|....*
Feature 1                                            
1OVL_A        237 TLCTQGLQRIFYLKLEDLVPPPAIIDKLFLDTLPF 271
1PDU_A        210 SLSVQGLQRIFYLKLEDLVPAPALIENMFVTTLPF 244
1YJE_A        230 TLCTQGLQRIFCLKLEDLVPPPPIVDKIFMDTLSF 264
gi 47060281   559 RSQRTQGLQRIXYLKLEDLVPPPPLIDRFLDTLPY 593
gi 82252975   616 RSQRTQGLQRIFYLKLEDLVQPPPLIDRFLDTLPY 650
gi 118343914 1019 ALAKMGGRRIQRHSIESPGVRVPHCLQRNLSTNML 1053
gi 74938425   306 HVSSKMATECLFAKSFLNLAVPQVMSFVMEMKVEI 340
gi 16797872   413 MFSEKALENYVTLEFFGKLDMPPLGRSSWSKLKTA 447
1OVL_B        237 TLCTQGLQRIFYLKLEDLVPPPAIIDKLFLDTLPF 271
gi 115623739  689 VLSKKGRQRLCALKVEGAAPVPGTIEKTYEPNLPY 723

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap