2AX9,2AA6,1SR7,1NHZ,3CLD,1M2Z,1XJ7,1T73,1T5Z,1XOW,2Q7K,1SQN,1E3K,1A28,2AA2,2A3I,2OAX,1Y9R,2ABI,3BQD


Conserved Protein Domain Family
NR_LBD_GR_Like

?
cd06947: NR_LBD_GR_Like 
Click on image for an interactive view with Cn3D
Ligand binding domain of nuclear hormone receptors:glucocorticoid receptor, mineralocorticoid receptor , progesterone receptor, and androgen receptor
The ligand binding domain of GR_like nuclear receptors: This family of NRs includes four distinct, but closely related nuclear hormone receptors: glucocorticoid receptor (GR), mineralocorticoid receptor (MR), progesterone receptor (PR), and androgen receptor (AR). These four receptors play key roles in some of the most fundamental physiological functions such as the stress response, metabolism, electrolyte homeostasis, immune function, growth, development, and reproduction. The NRs in this family use multiple signaling pathways and share similar functional mechanisms. The dominant signaling pathway is via direct DNA binding and transcriptional regulation of target genes. Another mechanism is via protein-protein interactions, mainly with other transcription factors such as nuclear factor-kappaB and activator protein-1, to regulate gene expression patterns. Both pathways can up-regulate or down-regulate gene expression and require ligand activation of the receptor and recruitment of other cofactors such as chaperone proteins and coregulator proteins. Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, GR, MR, PR, and AR share the same modular structure with a central well conserved DNA binding domain (DBD), a variable N-terminal domain, a flexible hinge and a C-terminal ligand binding domain (LBD).
Statistics
?
PSSM-Id: 132745
View PSSM: cd06947
Aligned: 35 rows
Threshold Bit Score: 466.068
Threshold Setting Gi: 169146179
Created: 19-Nov-2008
Updated: 17-Jan-2013
Structure
?
Program:
Drawing:
Aligned Rows:
 
Conserved site includes 21 residues -Click on image for an interactive view with Cn3D
Feature 1:ligand binding site [chemical binding site]
Evidence:
  • Structure:1NHZ_a; human Glucocorticoid receptor binds to antagonist RU-486, contacts at 4A
    View structure with Cn3D
  • Structure:3CLD_a; human glucocoticoid receptor binds to agonist fluticasone furoate, contacts at 4A
    View structure with Cn3D

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                    #  ## ##  #                             ##  ##  #  
2AX9_A        9 IFLNVLEAIEPGVVCAGHDNNQPDSFAALLSSLNELGERQLVHVVKWAKALPGFRNLHVDDQMAVIQYSWMGLMVFAMGW 88
1SR7_A       12 PLINLLMSIEPDVIYAGHDNTKPDTSSSLLTSLNQLGERQLLSVVKWSKSLPGFRNLHIDDQITLIQYSWMSLMVFGLGW 91
1NHZ_A       34 TLVSLLEVIEPEVLYAGYDSSVPDSTWRIMTTLNMLGGRQVIAAVKWAKAIPGFRNLHLDDQMTLLQYSWMSLMAFALGW 113
gi 46576435 530 IFLNVLEAIEPMVVCSGHDNNQPDSFALLLSSLNELGERQLVHVVKWAKALPGFRNLHVNDQMTVIQYSWMGLMIFAMGW 609
gi 82213368  86 IFLNVLEAIEPGVVCAGHDNSQPDSFSNLLSSLNELGERQLVYVVKWAKALPGFRNLHVDDQMSIIQYSWMGLMVFAMGW 165
gi 82225292 602 MFLNILEAIEPEVVNAGHDYGQPDSAASLLTSLNELGERQLVKVVKWAKGMPGFRSLYVDDQMTVIQHSWMAVMVFALGW 681
gi 130893   539 PMISVLRGIEPEVVYAGYDNTKPETPSSLLTSLNHLCERQLLCVVKWSKLLPGFRNLHIDDQITLIQYSWMSLMVFAMGW 618
gi 82216083 456 ELLQILQSIEPEVVYAGYDNTQPETPSALLSSLNQLCERQLVCVVKWSKSLPGFRNLHIDDQITLLQYSWMSLMVFALGW 535
1SQN_A       14 PLINLLMSIEPDVIYAGHDNTKPDTSSSLLTSLNQLGERQLLSVVKWSKSLPGFRNLHIDDQITLIQYSWMSLMVFGLGW 93
1E3K_A       11 PLINLLMSIEPDVIYAGHDNTKPDTSSSLLTSLNQLGERQLLSVVKWSKSLPGFRNLHIDDQITLIQYSWMSLMVFGLGW 90
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1       #           #               #   #  #                                            
2AX9_A       89 RSFTNVNSRMLYFAPDLVFNEYRMHKSRMYsqCVRMRHLSQEFgwLQITPQEFLCMKALLLFSIIPVDGLKnQKFFDELR 168
1SR7_A       92 RSYKHVSGQMLYFAPDLILNEQRMKESSFYslCLTMWQIPQEFvkLQVSQEEFLCMKVLLLLNTIPLEGLRsQTQFEEMR 171
1NHZ_A      114 RSYRQSSANLLCFAPDLIINEQRMTLPDMYdqCKHMLYVSSELhrLQVSYEEYLCMKTLLLLSSVPKDGLKsQELFDEIR 193
gi 46576435 610 RSFKNVNSRMLYFAPDLVFNEYRMHKSRMYsqCVRMRHLSQEFgwLQVTPEEFLCDEGPSALSIIPVEGLKdQKCFDELR 689
gi 82213368 166 RSFTNVNSRMLYFAPDLVFNEYRMHKSRMYsqCIRMRHLSQEFgwLQITPQEFLCMKALLFFSIIPVDGLKnQKLFDELR 245
gi 82225292 682 RSFKNVKSRMLYFAPDLVFNEHRMQVSTMYehCIRMKNFSQEFamLQVSQEEFLCMKALLLFSTIPVEGLKgQNFFDELR 761
gi 130893   619 RSYKHVSGQMLYFAPDLILNEQRMKESSFYslCLSMWQLPQEFvrLQVSQEEFLCMKALLLLNTIPLEGLRsQSQFDEMR 698
gi 82216083 536 RSYQHVSGQMLYFAPDLILNEQRMKDSSFYtlCLSMWQLPQEFmkLQVTHEEFLCMKALLLLNTIPLEGLKsQTNFDEMR 615
1SQN_A       94 RSYKHVSGQMLYFAPDLILNEQRMKESSFYslCLTMWQIPQEFvkLQVSQEEFLCMKVLLLLNTIPLEGLRsQTQFEEMR 173
1E3K_A       91 RSYKHVSGQMLYFAPDLILNEQRMKESSFYslCLTMWQIPQEFvkLQVSQEEFLCMKVLLLLNTIPLEGLRsQTQFEEMR 170
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                #  ##  #            #                  
2AX9_A      169 MNYIKELDRIIackrknptscSRRFYQLTKLLDSVQPIARELHQFTFDLLiks--hmvSVDFPEMMAEIISVQVPKILSG 246
1SR7_A      172 SSYIRELIKAIglrqkgvvssSQRFYQLTKLLDNLHDLVKQLHLYCLNTFiqs--ralSVEFPEMMSEVIAAQLPKILAG 249
1NHZ_A      194 MTYIKELGKAIvkregnssqnWQRFYQLTKLLDSMHEVVENLLNYCFQTFldk---tmSIEFPEMLAEIITNQIPKYSNG 270
gi 46576435 690 MNYIKELDRVIsckrnnpassSPRFFNLPKLLGSVQPIDVNLVQFTFGLFgka--qmvSVDFPEMMSEIISVQVPKILSG 767
gi 82213368 246 MNYIKELDRIIackrknptscSRRFYQLTKVLDSVHPIAKDLHQFTFDLLika--hmvSVDYPEMMAEIISVQVPKILSG 323
gi 82225292 762 RSYINELDRLVsfrs--ksscSERFQQLTRLLDSLQPVLKKLHQFTFDLFvqsqnlsnQVCFPEMISEIISVHVPKILAG 839
gi 130893   699 TSYIRELVKAIglrqkgvvanSQRFYQLTKLMDSMHDLVKQLHLFCLNTFlqs--ralSVEFPEMMSEVIAAQLPKILAG 776
gi 82216083 616 SNYIRELAKAIslrhkgviasSQRFYQLTKLMDSMHELVKQLHLYCLNTFlqs--rslSVEFPEMMSEVISAQLPKILAG 693
1SQN_A      174 SSYIRELIKAIglrqkgvvssSQRFYQLTKLLDNLHDLVKQLHLYCLNTFiqs--ralSVEFPEMMSEVIAAQLPKILAG 251
1E3K_A      171 SSYIRELIKAIglrqkgvvssSQRFYQLTKLLDNLHDLVKQLHLYCLNTFiqs--ralSVEFPEMMSEVIAAQLPKILAG 248

                ....*...
Feature 1               
2AX9_A      247 KVKPIYFH 254
1SR7_A      250 MVKPLLFH 257
1NHZ_A      271 NIKKLLFH 278
gi 46576435 768 RVKPLYFH 775
gi 82213368 324 KVKPIYFH 331
gi 82225292 840 TVKPILFH 847
gi 130893   777 MVKPLLFH 784
gi 82216083 694 MVKPLVFH 701
1SQN_A      252 MVKPLLFH 259
1E3K_A      249 MVKPLLFH 256

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap