1DSZ


Conserved Protein Domain Family
NR_DBD_RAR

?
cd06964: NR_DBD_RAR 
Click on image for an interactive view with Cn3D
DNA-binding domain of retinoic acid receptor (RAR) is composed of two C4-type zinc fingers
DNA-binding domain of retinoic acid receptor (RAR) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. RAR interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation. RARs mediate the biological effect of retinoids, including both natural dietary vitamin A (retinol) metabolites and active synthetic analogs. Retinoids play key roles in a wide variety of essential biological processes, such as vertebrate embryonic morphogenesis and organogenesis, differentiation and apoptosis, and homeostasis. RAR function as a heterodimer with retinoic X receptor by binding to specific RAR response elements (RAREs), which are composed of two direct repeats of the consensus sequence 5'-AGGTCA-3' separated by one to five base pair and found in the promoter regions of retinoid target genes. Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, retinoic acid receptors have a central well conserved DNA binding domain (DBD), a variable N-terminal domain, a non-conserved hinge and a C-terminal ligand binding domain (LBD).
Statistics
?
PSSM-Id: 143522
View PSSM: cd06964
Aligned: 7 rows
Threshold Bit Score: 138.893
Threshold Setting Gi: 9955273
Created: 21-Nov-2008
Updated: 17-Jan-2013
Structure
?
Program:
Drawing:
Aligned Rows:
 
Conserved site includes 8 residues -Click on image for an interactive view with Cn3D
Feature 1:zinc binding site [ion binding site]
Evidence:
  • Structure:1DSZ_A; C4 type zinc fingers of human RAR, contacts determined at 4A
    View structure with Cn3D
  • Comment:Zinc finger, C4-type: The domain contains two groups of four Cys residues. Each group is involved in the coordination of a single zinc atom.

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1              #  #             #  #               #     #         #  #                  
1DSZ_A         1 PRIYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMVYTCHRDKNCIINKVTRNRCQYCRLQKCFEVGMSKESVRND 80
gi 39980009  261 EVSTRMCVVCGDKASGFHYGVSTCEGCKGFFRRAIQRDQSYTCAKNGTCEINKTLRNKCQQCRLLKCIAVGMSRDAVRKR 340
gi 1710711    82 PRIYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMVYTCHRDKNCIINKVTRNRCQYCRLQKCFEVGMSKESVRND 161
gi 17367843   82 PRVYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMVYTCHRDKNCVINKVTRNRCQYCRLQKCFEVGMSKESVRND 161
gi 118572702  71 PRVYKPCFVCQDKSSGYHYGVSSCEGCKGFFRRSIQKNMVYTCHRDKNCQINKVTRNRCQYCRLQKCFEVGMSKEAVRND 150
gi 115681476  32 PRVYKPCFVCADKSSGYHYGVSACEGCKGFFRRSVQKNMQYTCHRDQKCIINKVTRNRCQHCRLKKCFEVGMSKECVRND 111
gi 118343970 292 PRIYKPCFVCGDKSSGYHYGVASCEGCKGFFRRSVQKNMQYTCHRNKQCLINKSTRSRCQYCRLQKCIQAGMLRESVRND 371

                 ....*
Feature 1             
1DSZ_A        81 RNKKK 85
gi 39980009  341 RQGKK 345
gi 1710711   162 RNKKK 166
gi 17367843  162 RNKKK 166
gi 118572702 151 RNKKK 155
gi 115681476 112 RNKKK 116
gi 118343970 372 RNKKR 376

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap