1T8P,1SK8,2F90,1NT4,1SK9,1H2E,2IKQ,1DKQ,2GFI,1QFX,1IHP,1QWO,1DKM,1CVI,3F2I,2RFL,1UJB,3D8H,1YFK,1XQ9,3EZN,1E59,1RII,3PGM,1FZT,3E9C,3DCY,3EOZ,3F3K,2A6P,2QNI,2P6O,2AXN,1K6M


Conserved Protein Domain Family
HP

?
cd07040: HP 
Click on image for an interactive view with Cn3D
Histidine phosphatase domain found in a functionally diverse set of proteins, mostly phosphatases; contains a His residue which is phosphorylated during the reaction.
Catalytic domain of a functionally diverse set of proteins, most of which are phosphatases. The conserved catalytic core of this domain contains a His residue which is phosphorylated in the reaction. This set of proteins includes cofactor-dependent and cofactor-independent phosphoglycerate mutases (dPGM, and BPGM respectively), fructose-2,6-bisphosphatase (F26BP)ase, Sts-1, SixA, histidine acid phosphatases, phytases, and related proteins. Functions include roles in metabolism, signaling, or regulation, for example F26BPase affects glycolysis and gluconeogenesis through controlling the concentration of F26BP; BPGM controls the concentration of 2,3-BPG (the main allosteric effector of hemoglobin in human blood cells); human Sts-1 is a T-cell regulator; Escherichia coli Six A participates in the ArcB-dependent His-to-Asp phosphorelay signaling system; phytases scavenge phosphate from extracellular sources. Deficiency and mutation in many of the human members result in disease, for example erythrocyte BPGM deficiency is a disease associated with a decrease in the concentration of 2,3-BPG. Clinical applications include the use of prostatic acid phosphatase (PAP) as a serum marker for prostate cancer. Agricultural applications include the addition of phytases to animal feed.
Statistics
?
PSSM-Id: 132716
View PSSM: cd07040
Aligned: 425 rows
Threshold Bit Score: 30.0745
Threshold Setting Gi: 75148289
Created: 8-Jan-2008
Updated: 17-Jan-2013
Structure
?
Program:
Drawing:
Aligned Rows:
 
catalytic core
Conserved site includes 5 residues -Click on image for an interactive view with Cn3D
Feature 1:catalytic core [active site]
Evidence:
  • Comment:The catalytic core includes a His group which is phosphorylated during phosphoryl transfer as well as two key Arg residues and an additional His residue which are hydrogen bonded to the phospho group before, during, and after transfer.
  • Structure:1H2E_A, Bacillus stearothermophilus PhoE phosphatase bound with phosphate ion, contacts at 3.5A
    View structure with Cn3D
  • Structure:2IKQ_A, Mus musculus Sts-1 (Suppressor of T- Cell Receptor) phosphatase domain bound with phosphate ion, contacts at 3.5A.
    View structure with Cn3D
  • Structure:1SK8_A, Aspergillus fumigates phytase bound with phosphate ion, contacts at 3.5 A.
    View structure with Cn3D
  • Structure:1NT4_A, Escherichia coli periplasmic glucose-1-phosphatase H18A mutant bound with glucose-1-phosphate, contacts at 3.5 A.
    View structure with Cn3D
  • Structure:2F90_A, human bisphosphoglycerate mutase homodimer bound with 3-phosphoglycerate and Alf4-, contacts at 3.5 A.
    View structure with Cn3D
  • Comment:Alf4- mimics the intermediate in phosphoryl transfer reactions.
  • Citation:PMID 1429631
  • Citation:PMID 8407904

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1            ##                                                                         
1T8P_A        5 KLIMLRHGEGAwnkenr--------------------------------fcswvdQKLNSEGMEEARNCGKQLkaln--- 49
gi 2506973   55 VVVLFRHAERCdrstnq---------------------------------clsdkTGITVKGTQDARELGNAFsadi--- 98
1H2E_A        3 TLYLTRHGETKwnverr--------------------------------mqgwqdSPLTEKGRQDAMRLGKRLeav---- 46
2IKQ_A        6 CLFVCRHGERMdvvfgkywlsqcfdakgryirt-nlnmphslpqrsggfrdyekdAPITVFGCMQARLVGEALlesn--- 81
gi 82108547  78 LTAIVRHGTRYptgknikkmhdfyelmkssavg-reswlqelqnqwtmwytedmdGRLVQKGVDDLKNLAVRLsklfpsm 156
gi 82185870  58 MVSVIRHGTRYpttknvrkiaqlfdlvksdslr-sasswlndlktwkmwytedmdGRLVEKGRDDHRHLAMRLaksfptl 136
gi 10720337 493 KIYIMRHGERVdftfgtwipycfdefgnymrk--dlnmpktlprrknspegwqndSPLTNVGVYQANLIGQALleaq--- 567
gi 74965996   5 RVFIIRHGERCdfafgksglwinsfdsrgryrpldinlprtlpkradgwqgfaadTPLTEIGYLQSKLTGRALrdng--- 81
gi 10720330 397 SVLVVRHGERVdqifgkawlqqcstpdgkyyrp-dlnfpcslprrsrgikdfendPPLSSCGIFQSRIAGDALldsg--- 472
gi 74810646  74 WVFALRHGERVdltygpwvphcfendtyvrkd---lnlplklahraggkggyvkdTPLTRLGWFQAQLVGEGMrmag--- 147
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                          #                                                            
1T8P_A       50 -------fefdLVFTSVLNRSIHTAWLILeelg-qewvPVE-SSWRlnerhygaliglnreqmalnhgeeqvrlwrrsyn 120
gi 2506973   99 --------pdfDLYSSNTVRTIQSATWFSag------kKLT-VDKRllq------------------------------- 132
1H2E_A       47 --------elaAIYTSTSGRALETAEIVRggr----liPIY-QDERlreihlgdwegkthdeirqmdpia---------- 103
2IKQ_A       82 -------tvidHVYCSPSLRCVQTAHNILkglqqdnhlKIR-VEPGlfewtkwvagstlpawippselaaan-------- 145
gi 82108547 157 iseeklragmiKFITSSKHRCVNSTLSFKagl----teLWAiSDQEiehtvndalmrffdqctrfvqevdgnpsalseve 232
gi 82185870 137 isadhlranriEFMTSSKHRCVDSVKAFQegl----hrLWDvQDMDyqhyvddslmryfdhcekfvegvennktalkevq 212
gi 10720337 568 -------vqidHVYCSPSYRCIQTCTSALeglkltgkqKIK-LEPGlfewmawypsgvpdwltknelteakfd------- 632
gi 74965996  82 -------ieinHVFCSPALRCIQTTVGLLkgmgldkriQFS-VEPGlyewmvfaryarpcwippkdlkklgy-------- 145
gi 10720330 473 -------irisSVFASPALRCVQTAKLILeelklekkiKIR-VEPGifewtkweagkttptlmsleelkean-------- 536
gi 74810646 148 -------vsikHVYASPALRCVETAQGFLdglradpsvKIK-VEPGlfefknwhmpkgidfmtpielckag--------- 210
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                       
1T8P_A      121 vtpp--------------------------------------------pieeshpyyqeiyndrrykvcdvpldqlprse 156
gi 2506973      --------------------------------------------------------------------------------
1H2E_A      104 ---------------------------------------------------------------fdhfwqaphlyapqrge 120
2IKQ_A      146 ------------------------------------------------------------lsvdttyrphipvsklaise 165
gi 82108547 233 sfrlgpemrrvqekiaerlrvpysditcdsaeaafylcayefaiktvnspwcrlfdqvdaqimeyandlkqfwkrgyghd 312
gi 82185870 213 rfksssemdsvrrkissrlqipydritadmaeaafflcsyefaikseyspwcelldesdaqvleykndlkqywkrgyghd 292
gi 10720337 633 ------------------------------------------------------------vdldyepvqpaseltarlke 652
gi 74965996 146 -------------------------------------------------------------pvqenyvpcwtdkelrmne 164
gi 10720330 537 ------------------------------------------------------------fnidtdyrpafplsalmpae 556
gi 74810646 211 --------------------------------------------------------------lnvdmtykpyvemdasae 228
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                              ##                                       
1T8P_A      157 slkdvlERLLPYWNERiapev--------lrgkTILISAHGNSSRALLKHLegisdedi---------------initlp 213
gi 2506973  133 ----cgNEIYSAIKDLqska----------pdkNIVIFTHNHCLTYIAKDKrdatfk-------------------pdyl 179
1H2E_A      121 rfcdvqQRALEAVQSIvdrh----------egeTVLIVTHGVVLKTLMAAFkdtpldhlw--------------sppymy 176
2IKQ_A      166 sydtyiNRSFQVTKEIiseck--------skgnNILIVAHASSLEACTCQLqglspqnskdf----------vqmvrkip 227
gi 82108547 313 inskssCILFHDLFSRlekavsdhksgqkvteaVTVQVGHAKTLLPLLTLLgffkdnnrmtsvnyaaqtrrsfrtslmvp 392
gi 82185870 293 inrkssCPLFHDIFSRldnaakdh-rfgevkktATIQVGHGETLLPLLSLMgffkdekpltsenfalqrkrvfrsskilp 371
gi 10720337 653 steqfyERNHDVILQLleq-----------ttgNILVVAHATTLDTCSRQLtggvprstnel----------rqvihkip 711
gi 74965996 165 tladfyQRSFGSINKIlsec----------tegNILIVAHGASLETCTRQLvggdirstddf----------yyllqntp 224
gi 10720330 557 syqeymDRCTASMVQIvntcp--------qdtgVILIVSHGSTLDSCTRPLlglpprecgdf----------aqlvrkip 618
gi 74810646 229 tmdeffKRGEVAMQAAvndte--------kdggNVIFIGHAITLDQMVGALhrlrddmedvqpy------eigrnllkvp 294
                       330       340
                ....*....|....*....|..
Feature 1                             
1T8P_A      214 tgVPILLElden-lraVGpHQF 234
gi 2506973  180 dgLVMHVE--------KGkVYL 193
1H2E_A      177 gtSVTIIEvdg--gtfHVaVEG 196
2IKQ_A      228 ylGFCSCEelgetgiwQL-TDP 248
gi 82108547 393 yaANLVLVlydcgnddLRlQPL 414
gi 82185870 372 yaANVVFVlyec-sdgLRvQLF 392
gi 10720337 712 ycSLATVEqvd--gvwKL-VEP 730
gi 74965996 225 ylSCVEVNsre--glwRL-VGS 243
gi 10720330 619 slGMCFCEenkeegkwEL-VNP 639
gi 74810646 295 ycALGAMRgk----pwDV-VSP 311

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap