Conserved Protein Domain Family
BMC_PduA

?
cd07059: BMC_PduA 
1,2-propanediol utilization protein A (PduA), Bacterial Micro-Compartment (BMC) domain
PduA is encoded within the 1,2-propanediol utilization (pdu) operon along with other homologous carboxysome shell proteins PduB, B', J, K, T, and U. PduA is thought to be required for the formation of the outer shell of bacterial pdu polyhedral organelles which are involved in coenzyme B12-dependent degradation of 1,2-propanediol. Although it has been suggested that PduA might form hexamers and further assemble into the flat facets of the polyhedral outer shell of pdu organelles, like PduU does, at present no experimental evidence directly supports this view.
Statistics
?
PSSM-Id: 132899
View PSSM: cd07059
Aligned: 10 rows
Threshold Bit Score: 110.337
Threshold Setting Gi: 116619522
Created: 20-Nov-2008
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
 
HexamerPutative
Feature 1:Hexamer interface [polypeptide binding site]
Evidence:
  • Comment:Based on Synechocystis sp. CcmK2 (2A1B) and CcmK4 (2A10)

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1             #  #        #  ##     #    #  ###                              ### # ##  # 
gi 18309885    6 ALGMIETRGLVGAIEAADAMVKAANVQLVGKEQVGGGLVTVMVRGDVGAVKAATDAGAAAAERVGDLISVHVIPRPHFEV 85
gi 119718249   8 ALGMIETRGLVGSIEAADAMVKAANVTLIGKEHIGGGYVTVMVRGDVGAVKAATDAGAAAAQRVGDLVSVHVIPRPHGDV 87
gi 29376182    6 ALGMIETRGLVGAVEAADAMVKAANVTLIGKEQVGGGLVTVMVRGDVGAVKAATDAGAAAAERVGELLSVHVIPRPHTEV 85
gi 19703435    6 ALGMIETKGLVAAVEAADAMVKAANVTLVGKELVGGGLVTVMVRGDVGAVKAATDAGAAAADRVGELISVHVIPRPHSEV 85
gi 193215582   5 ALGMIETKGLVGAIEAADAMVKAANVDLIGKETIGGGFVTVMVRGDVGAVKAATDAGAAAAQRVGELVSVHVIPRPHSEV 84
gi 154495808 138 ALGMVETRGLVAAIEAADAMVKAANVQLVGKEQVGGGLVTVMVRGDVGAVKAATDAGAAAAEKVGELVSVHVIPRPHAEV 217
gi 116619522   3 ALGMIETKGLTGAIEAADAMVKTANVVLIGKEFVGAGLVMVQVRGDVGAVKAATDAGAAAARRVGELVSVHVIPRPHEEV 82
gi 60392892    5 ALGMVETKGLTAAIEAADAMVKSANVMLVGYEKIGSGLVTVIVRGDVGAVKAATDAGAAAARNVGEVKAVHVIPRPHTDV 84
gi 83592241    5 ALGMVETKGLVGAIEAADAMVKSANVVLMGYEKIGSGLVTVMVRGDVGAVKAATDAGAVAASKIGEVVSVHVIPRPHTEV 84
gi 124263038  18 ALGLIETKGLVGAIEAADAMVKAANVRLVGREQIGGGLVTVMVRGDVGAVKAATDAGAAAAGKIGEIVSVHVIPRPHEDV 97

                 ....*
Feature 1             
gi 18309885   86 DAILP 90
gi 119718249  88 EFILP 92
gi 29376182   86 DAILP 90
gi 19703435   86 ELILP 90
gi 193215582  85 EAILP 89
gi 154495808 218 DFVLP 222
gi 116619522  83 EKILP 87
gi 60392892   85 EKILP 89
gi 83592241   85 EKILP 89
gi 124263038  98 EGILP 102

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap