Conserved Protein Domain Family

cd07061: HP_HAP_like 
Click on image for an interactive view with Cn3D
Histidine phosphatase domain found in histidine acid phosphatases and phytases; contains a His residue which is phosphorylated during the reaction.
Catalytic domain of HAP (histidine acid phosphatases) and phytases (myo-inositol hexakisphosphate phosphohydrolases). The conserved catalytic core of this domain contains a His residue which is phosphorylated in the reaction. Functions in this subgroup include roles in metabolism, signaling, or regulation, for example Escherichia coli glucose-1-phosphatase functions to scavenge glucose from glucose-1-phosphate and the signaling molecules inositol 1,3,4,5,6-pentakisphosphate (InsP5) and inositol hexakisphosphate (InsP6) are in vivo substrates for eukaryotic multiple inositol polyphosphate phosphatase 1 (Minpp1). Phytases scavenge phosphate from extracellular sources and are added to animal feed while prostatic acid phosphatase (PAP) has been used for many years as a serum marker for prostate cancer. Recently PAP has been shown in mouse models to suppress pain by functioning as an ecto-5prime-nucleotidase. In vivo it dephosphorylates extracellular adenosine monophosphate (AMP) generating adenosine,and leading to the activation of A1-adenosine receptors in dorsal spinal cord.
PSSM-Id: 132717
View PSSM: cd07061
Aligned: 114 rows
Threshold Bit Score: 58.9248
Threshold Setting Gi: 19075377
Created: 29-Sep-2008
Updated: 17-Jan-2013
Aligned Rows:
catalytic core
Conserved site includes 6 residues -Click on image for an interactive view with Cn3D
Feature 1:catalytic core [active site]
  • Comment:The catalytic core includes a His group which is phosphorylated during phosphoryl transfer as well as two key Arg residues and an additional His residue which are hydrogen bonded to the phospho group before, during, and after transfer.
  • Structure:1NT4_A, Escherichia coli periplasmic glucose-1-phosphatase H18A mutant bound with glucose-1-phosphate, contacts calculated at 3.5 A.
    View structure with Cn3D
  • Structure:1SK9_A, Aspergillus fumigates phytase bound with phosphate ion, contacts calculated at 3.5 A.
    View structure with Cn3D
  • Structure:1DKQ_A, Escherichia coli phytase H17A mutant at pH5 bound with phytate having its 3-phosphate in the active site, contacts calculated at 3.5 A.
    View structure with Cn3D
  • Comment:E. coli phytase is expected to bind phytate similarly at pH5 as it does at its pH optimum of 4.5.
  • Citation:PMID 8407904
  • Citation:PMID 1429631

Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
Feature 1                  ##  #                                                                  
1SK8_A         45 RITLVQVLSRHGARYPtsskskkykklvtaiqana--------------------------------------------- 79
1NT4_A          8 QLQQVLMMSRANLRAPlanngsvleqst---------------------------------------------------- 35
gi 156370256  345 ELRCVIGIIRHGDRTPkqklkmeirhprfiqlfkrhnshnekklklkrpkqlqeildivrdlleehhagvtmfen----- 419
gi 47213066   446 ELRCVIAVIRHGDRTPkqkmkmgspqphvtffdlfekyggyktgklklkkpkqlqevlditrqllaelgqhndcei---- 521
gi 118096054  390 ELRCVIAVIRHGDRTPkqkmkmevkhprffelfekydgyktgklklkkpeqlqevldiarqlvvelgthsdceiee---- 465
gi 166227888  385 ELRCVIAVIRHGDRTPkqkmkmevrhqkffdlfekcdgyksgklklkkpkqlqevldiarqllmelgqnndseie----- 459
gi 148234360  393 ELRCVIAVIRHGDRTPkqkmkmevrhqrffdlfekyhgyktgkiklkkpkqlqevldiarqllvelgqnndseie----- 467
gi 74870513   402 ELRCVVAVIRHGDRTPkqkmkvevrhpkffeifekydgyklghvklkrpkqlqeildiarfllseihtkahaeieekesk 481
gi 74644969   538 VFKGLAIIIRHADRTPkqkfkhsftspifisllkghkeevvirnvndlkivlqalrialdeka----------------- 600
gi 74608217   510 VFKGLVTVIRHADRTPkqkfkhsftspifisllkghkeevvirkvndlkivlqalrialeeka----------------- 572
                          90       100       110       120       130       140       150       160
Feature 1                                                                                         
1SK8_A         80 ---------------------------------------------------------tdfkgkfaflktynytlgaDDLT 102
1NT4_A         36 -----------------------------------------------------------------pnkwpewdvpgGQLT 50
gi 156370256  420 -----------------pnklrqlknvlemyghfsginrkiqlkylgfvkdtpdssekayksskdeeaillimkwgGELT 482
gi 47213066   522 ----------------eekkskleqlktvlemyghfsginrkvqltylphgqpktsseeedtrkegpslllvlkwgGELT 585
gi 118096054  466 -----------------rkskleqlksvlemyghfsginrkvqltylphghpkaasedeearrepspslllvlkwgGELT 528
gi 166227888  460 -----------------enkskleqlktvlemyghfsginrkvqltylphgcpktsseeednrreepslllvlkwgGELT 522
gi 148234360  468 -----------------eskakleqlktvlemyghfsginrkvqltylphgcpktsseeedcrreepslllvlkwgGELT 530
gi 74870513   482 leqlknvlemyghfsginrkvqmkyqpkgrprgsssddskssrispnpsasinqseanlaadqpvepslvlilkwgGELT 561
gi 74644969   601 ------------------------------gnpakikvlanalekklnfpgtkiqlkpvlnkenevekvqfilkwgGEPT 650
gi 74608217   573 ------------------------------gnptkikllantlekklelpgtkiqlkpvltqnnevekvqfilkwgGEPT 622
                         170       180       190       200       210       220       230       240
Feature 1                                                               #                         
1SK8_A        103 PFGEQQLVNSGIKFYQRYkala-------------------rsvVPFIRASGSDRVIASGEKFIEGFQqakladpgatnr 163
1NT4_A         51 TKGGVLEVYMGHYMREWLaeqgmvks-----------gecpppyTVYAYANSLQRTVATAQFFITGAFpgc--------- 110
gi 156370256  483 ATGKIQAEELGRAFRCMYpggqgeysnlpg--cgllrlhstyrhDLKIYASDEGRVQMTAAAFAKGFL------------ 548
gi 47213066   586 PAGRVQAEELGRAFRCMYpggqgdyagfpg--cgllrlhstyrhDLKIYASDEGRVQMTAAAFAKGLL------------ 651
gi 118096054  529 PAGRVQAEELGRAFRCMYpggqgdyagfpg--cgllrlhstyrhDLKIYASDEGRVQMTAAAFAKGLL------------ 594
gi 166227888  523 PAGRVQAEELGRAFRCMYpggqgdyagfpg--cgllrlhstyrhDLKIYASDEGRVQMTAAAFAKGLL------------ 588
gi 148234360  531 PAGRVQAEELGRAFRCMYpggqgdyagfpg--cgllrlhstyrhDLKIYASDEGRVQMTAAAFAKGLL------------ 596
gi 74870513   562 PAGRIQAEELGRIFRCMYpggqgrsdysgtqglgllrlhstfrhDLKIYASDEGRVQMTAAAFAKGLL------------ 629
gi 74644969   651 HSAKYQATELGEQMRQDFdllnk-----------------silqNIKIFSSSERRVLHTAQYWTRALFg----------- 702
gi 74608217   623 HSARYQATELGEQMRQDFdllnk-----------------nilqDIKIFSSSERRVLVSAQYWATALFg----------- 674
                         250       260       270       280       290       300       310       320
Feature 1                                                                                         
1SK8_A        164 aapAISvIIPESETfnntldhgvctkfeasqlgdevaan----------------------------------------- 202
1NT4_A        111 -diPVH-HQEKMGTmdptfnpvitddsaafseqavaamekelsklqltdsyqlle------------------------- 163
gi 156370256  549 ---ALE-GELTPILvhlvrsdknttemldtsdqatklmtrvkqrlheilsqdkkftdedisklapt-------------- 610
gi 47213066   652 ---ALE-GELTPILvqmvksanmnglldndsdslsscqhrvkarlheilqtdkgfsdedydrlapt-------------- 713
gi 118096054  595 ---ALE-GELTPILvqmvksanmnglldsdsdslsscqhrvkarlheimqkdaefceedyeklapt-------------- 656
gi 166227888  589 ---ALE-GELTPILvqmvksanmnglldsdsdslsscqqrvkarlheilqkdrdftaedyekltps-------------- 650
gi 148234360  597 ---ALE-GELTPILvqmvksanmnglldsdsdslsscqhrvkarlheilqrdrdfssedfeklspt-------------- 658
gi 74870513   630 ---ALE-GELTPILvqmvksantnglldndcdsskyqnlakgrlhelmqndrefskedrelinpcnsksi---------- 695
gi 74644969   703 ---ADE-LGSDEISirkdllddsnaakdlmdkvkkklkpllregkeappqfawpskmpepylvikrvvelmnyhkkimdn 778
gi 74608217   675 ---ADE-FSSDEINirkdllddsnaakdimdkvkkklkpllregketppqfawpakmpepylvikrvvelmnyhkkimdh 750
                         330       340       350       360       370       380       390       400
Feature 1                                                                                         
1SK8_A            --------------------------------------------------------------------------------
1NT4_A            --------------------------------------------------------------------------------
gi 156370256  611 ----------------------------------------------------------------------------ksas 614
gi 47213066   714 ----------------------------------------------------------------------------qsas 717
gi 118096054  657 ----------------------------------------------------------------------------gsas 660
gi 166227888  651 ----------------------------------------------------------------------------gsis 654
gi 148234360  659 ----------------------------------------------------------------------------gsvs 662
gi 74870513   696 ------------------------------------------------------------------------tqaldfvk 703
gi 74644969   779 nfakkdvnsmqtrwctsedpslfkerwdklfkefnnaekvdpskiselydtmkydalhnrqflenifdpglpneaiadel 858
gi 74608217   751 nfetkdvsklqerwctsedpglfkerwnkl---fkefvsvekadpskiselydtmkydalhnreflqnifdpgelaneni 827
                         410       420       430       440       450       460       470       480
Feature 1                                                                                         
1SK8_A        203 -----------------------ftalfapdiraraekhlpgvtltdeDVVSLMDMCSFDtvartsdasq---------- 249
1NT4_A        164 -------kivnykdspackekqqcslvdgkntfsakyqqepgvsgplkVGNSLVDAFTLQyyegfpmdq----------- 225
gi 156370256  615 lieaikkvqnpremcaklanmvhdlteqlkdminqkkydprdpflyhdDTLELMTHRWIKldkdfrlkhgmydislipdi 694
gi 47213066   718 lvnsmkiiqnpvatcdlvytliqsltsqirkrmedpksadlqlyhsetLELMLQRWSKLErdfrmkngrydiskipdiyd 797
gi 118096054  661 llnsmtfiqnpveicnqvftlienltsqirkrledpksadlqlyhsetLELMLQRWSKLErdfrmkngrydiskipdiyd 740
gi 166227888  655 viksmhliknpvktcdkvysliqsltsqiryrmedpksadiqlyhsetLELMLRRWSKLEkdfktkngrydiskipdiyd 734
gi 148234360  663 qiksmhfiknpvktcdkvysliqsltsqirqrmedpkfadiqlyhsetLELMLRRWSKLEkdfktkngrydiskipdiyd 742
gi 74870513   704 npvdcchhvhllirellhiisikkddpktkdailyhgetwdlmrcrweKIEKDFSTKSKLfdiskipdiydcikydlqhn 783
gi 74644969   859 gshslvdrypinvlaknnfkiidshsmnnsgknssnsvgslgwvlesgKTSTARNPKSSSqfdeprfmql---------- 928
gi 74608217   828 snhslvdrypinvlarnnfkivdssyaagtssssktsvgslgwvlesgKTKVNSESKSASpfdgqkyvqf---------- 897
                         490       500       510       520       530       540       550       560
Feature 1                                                                                         
1SK8_A        250 -------------------------lspfcqlftHNEWk--kYNYLQSLGKYYGYgag------npLGPAQGIGFTNELI 296
1NT4_A        226 --------------------------vawgeiksDQQWk--vLSKLKNGYQDSLFts-------peVARNVAKPLVSYID 270
gi 156370256  695 ydgikydlqhnnqlglknttemynvakaladiviPQEYglsaEEKVKIARKMCIRll-------rkIQGDLKHADTEDTH 767
gi 47213066   798 cvkydv--ihnaslgledtlelfrlsraladiviPQEYg---INKVEKLDIAYGYclplvrkiqmdLQRTHEDESVNKLH 872
gi 118096054  741 cikydv--qhncalklegtaelfrfskaladviiPQEYg---INKEEKLEIAIGFclplikkiqldLQRTHEDESVNKLH 815
gi 166227888  735 cikydv--qhngslklentmelyrlskaladiviPQEYgi-tKAEKLEIAKGYCTplvrk--irsdLQRTQDDDTVNKLH 809
gi 148234360  743 cikydv--qhncslklentmelyrlskaladiviPQEYgi-sRPEKLEIAKGYCTplvrk--irsdLQRTQDDDTVNKLH 817
gi 74870513   784 qh----------tlqydqaeelyiyaknladiviPQEYgl-tPQEKLAIGQGICSp---------lLRKIKGDLQRNIDE 843
gi 74644969   929 -------------------------relyklakvLFDFicpkEYGISDAEKLDIGl---------lTSLPLAKQILNDIG 974
gi 74608217   898 -------------------------relyrlakvLFDFicpkEYGIEDAEKLDIGl---------lTSLPLAKQILNDID 943
                         570       580       590       600       610       620       630       640
Feature 1                                             ##                                          
1SK8_A        297 ARLTrspvqdhtstnstlvsnpatfplnatMYVDFSHDNSMVSIFFALglyngteplsrtsvesakeldgysaswvVPFG 376
1NT4_A        271 KALVtdrt------------------sapkITVLVGHDSNIASLLTALdfkpyql---------------hdqnerTPIG 317
gi 156370256  768 TRLNpeysqsvit--------phrhvrtrlYFTSESHVHSIINALRYGkmfesenqdaqwkr-aidflseipelhyMTQI 838
gi 47213066   873 PLYSrgvmspg------------rhvrtrlYFTSESHVHSLLSIFRYGglldeekdpqwkr--amdylsavselnyMTQI 938
gi 118096054  816 PLYSrgvlspg------------rhvrtrlYFTSESHVHSLLSIFRYGglldenkdqqwkr--amdylsaiselnyMTQI 881
gi 166227888  810 PVYSrgvlspe------------rhvrtrlYFTSESHVHSLLSILRYGalcddskdeqwkr--amdylnvvnelnyMTQI 875
gi 148234360  818 PLYSrgvmspe------------rhvrtrlYFTSESHVHSLLSILRFGalcdetkdeqwkr--amdylnvvselnyMTQI 883
gi 74870513   844 VEDEfmnrlnphyshg--vaspqrhvrtrlYFTSESHVHSLLTVLRYGgllnvvtdeqwrr--amdyismvselnyMSQI 919
gi 74644969   975 DMKNretp------------------acvaYFTKESHIYTLLNIIYESgipmriar------------nalpeldyLSQI 1024
gi 74608217   944 IMKNkeap------------------acvaYFTKESHIYTLLNIIYESgipmrias------------nalpefdyLSQI 993
                         650       660
Feature 1                                
1SK8_A        377 ARAYFETMqcksekEPLVRALIN 399
1NT4_A        318 GKIVFQRWhdskanRDLMKIEYV 340
gi 156370256  839 VLMLYEDPta--dlQSDNRFHIE 859
gi 47213066   939 VIMLYEDNnk--dlSSEERFHVE 959
gi 118096054  882 VIMLYEDNnk--dpSSEERFHVE 902
gi 166227888  876 VIMLYEDPnk--dlSSEERFHVE 896
gi 148234360  884 VIMLYEDPnk--dvSSEERFHVE 904
gi 74870513   920 VIMLYEDPtk--dpTSEERFHVE 940
gi 74644969  1025 TFELYESTdasgqkSHSIRLKMS 1047
gi 74608217   994 NFELYESTdanevkSHSIRLKMS 1016

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap