1YOW,1YP0,1YMT,1ZDT


Conserved Protein Domain Family
NR_LBD_SF-1

?
cd07070: NR_LBD_SF-1 
Click on image for an interactive view with Cn3D
The ligand binding domain of nuclear receptor steroidogenic factor 1, a member of nuclear receptor superfamily
The ligand binding domain of nuclear receptor steroidogenic factor 1 (SF-1): SF-1, a member of the nuclear hormone receptor superfamily, is an essential regulator of endocrine development and function and is considered a master regulator of reproduction. Most nuclear receptors function as homodimer or heterodimers, however SF-1 binds to its target genes as a monomer, recognizing the variations of the DNA sequence motif, T/CCA AGGTCA. SF-1 functions cooperatively with other transcription factors to modulate gene expression. Phospholipids have been determined as potential ligands of SF-1. Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, SF-1 has a central well conserved DNA binding domain (DBD), a variable N-terminal domain, a flexible hinge and a C-terminal ligand binding domain (LBD).
Statistics
?
PSSM-Id: 132755
View PSSM: cd07070
Aligned: 7 rows
Threshold Bit Score: 420.513
Threshold Setting Gi: 67463977
Created: 10-Dec-2008
Updated: 17-Jan-2013
Structure
?
Program:
Drawing:
Aligned Rows:
 
ligand bindingcorepressor
Conserved site includes 21 residues -Click on image for an interactive view with Cn3D
Feature 1:ligand binding site [chemical binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                #  #                                    
1YOW_A         4 VPELMLQLLQLEPDEDQVRARILGCLQEPtksrp-dqpaaFGLLCRMADQTFISIVDWARRCMVFKELEVADQMTLLQNC 82
1YP0_A         2 VPELILQLLQLEPEEDQVRARIVGCLQEPaksrs-dqpapFSLLCRMADQTFISIVDWARRCMVFKELEVADQMTLLQNC 80
1YMT_A         8 VPELILQLLQLEPEEDQVRARIVGCLQEPaksrs-dqpapFSLLCRMADQTFISIVDWARRCMVFKELEVADQMTLLQNS 86
1ZDT_A         3 VPELILQLLQLEPDEDQVRARILGSLQEPtksrp-dqpaaFGLLCRMADQTFISIVDWARRCMVFKELEVADQMTLLQNC 81
gi 4586618   227 IPEVILKLLQLEPDEAQVKARILACLQQEqgkgrheklstFGLMCKMADQTLFSIVEWARSCIFFKELEVGDQMKLLQNC 306
gi 49036491  225 VPELILKLLQLEPDEGQLKARILACLQEPskgrp-drptpFGLMCKMADQTLFSIVEWARSCVVFKELEVADQMKLLQNC 303
gi 148224522 229 IPEVILKLLQPEPDEPQVKARILSCLQQEqnkgrheklnmFGLMCKMADQTLFSIVEWARSCIYFKELEVSDQVILLQNC 308
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1         #  ##  #            # #     #   ##  ###  #      #                              
1YOW_A        83 WSELLVFDHIYRQVQHGKEGSILLVTGQEVELTTVATQAGSLLHSLVLRAQELVLQLLaLQLDRQEFVCLKFIILFSLDL 162
1YP0_A        81 WSELLVLDHIYRQVQYGKEDSILLVTGQEVELSTVAVQAGSLLHSLVLRAQELVLQLHaLQLDRQEFVCLKFLILFSLDV 160
1YMT_A        87 WSELLVLDHIYRQVQYGKEDSILLVTGQEVELSTVAVQAGSLLHSLVLRAQELVLQLHaLQLDRQEFVCLKFLILFSLDV 166
1ZDT_A        82 WSELLVFDHIYRQVQHGKEGSILLVTGQEVELTTVATQAGSLLHSLVLRAQELVLQLLaLQLDRQEFVCLKFIILFSLDL 161
gi 4586618   307 WSELLVFDHVYRQLQHGKEHSVLLVTGQEVDLSAVAAQAGSILHSLVLRAQELVLHLHsLQVDRQEFVCLKFLILFSLDV 386
gi 49036491  304 WSELLVFDHIYRQIQHGKEGSILLVTGQEVDLSTVAAQAGSLLHSLVLRAQDLVQQLHsLQVDRQEFVCLKFLILFSLDV 383
gi 148224522 309 WSELLVFDHIYRQMQHSKENSILLVTGQEIEVSAISSQAGSTLNNLILRAQELVIVLHsLQVDRQEFVCLKFLILFSLDE 388
                        170       180       190       200       210       220       230
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
Feature 1                                                        #  #  ##  #                   
1YOW_A       163 KFLNNHILVKDAQEKANAALLDYTLCHYPHCGDKFQQLLLCLVEVRALSMQAKEYLYHKHLGNEMPRNNLLIEMLQAK 240
1YP0_A       161 KFLNNHSLVKDAQEKANAALLDYTLCHYPHCGDKFQQLLLCLVEVRALSMQAKEYLYHKHLGNEMPRNNLLIEMLQAK 238
1YMT_A       167 KFLNNHSLVKDAQEKANAALLDYTLSHYPHSGDKFQQLLLSLVEVRALSMQAKEYLYHKHLGNEMPRNNLLIEMLQAK 244
1ZDT_A       162 KFLNNHILVKDAQEKANAALLDYTLCHYPHSGDKFQQLLLCLVEVRALSMQAKEYLYHKHLGNEMPRNNLLIEMLQAK 239
gi 4586618   387 KYLENHALAKDAQEKANAALLEYTVCHYPHCTDKFRQLLLRLTEVRALSMQAEEYLYHKHLSGEVPCNNLLIEMLHAK 464
gi 49036491  384 KFLENHGLAKDAQEKANSALLEYTMCHYPHCGDKFRQLLLRLAEVRSLSMQAEEYLYHKHLGGEVPCNNLLIEMLHAK 461
gi 148224522 389 KFLENHSLAKSAQEKVSSALLEYTMCHYPHCTDKYRMLLVRLAEIRSISMQAEEYLYHKHLSGEVPCNNLLIEMLHAK 466

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap