2AX9,1XJ7,1T73,1T5Z,1XOW,2Q7K


Conserved Protein Domain Family
NR_LBD_AR

?
cd07073: NR_LBD_AR 
Click on image for an interactive view with Cn3D
Ligand binding domain of the nuclear receptor androgen receptor, ligand activated transcription regulator
The ligand binding domain of the androgen receptor (AR): AR is a member of the nuclear receptor family. It is activated by binding either of the androgenic hormones, testosterone or dihydrotestosterone, which are responsible for male primary sexual characteristics and for secondary male characteristics, respectively. The primary mechanism of action of ARs is by direct regulation of gene transcription. The binding of an androgen results in a conformational change in the androgen receptor which causes its transport from the cytosol into the cell nucleus, and dimerization. The receptor dimer binds to a hormone response element of AR-regulated genes and modulates their expression. Another mode of action is independent of their interactions with DNA. The receptors interact directly with signal transduction proteins in the cytoplasm, causing rapid changes in cell function, such as ion transport. Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, AR has a central well conserved DNA binding domain (DBD), a variable N-terminal domain, a flexible hinge and a C-terminal ligand binding domain (LBD). The LBD is not only involved in binding to androgen, but also involved in binding of coactivator proteins and dimerization. A ligand dependent nuclear export signal is also present at the ligand binding domain.
Statistics
?
PSSM-Id: 132758
View PSSM: cd07073
Aligned: 9 rows
Threshold Bit Score: 486.753
Threshold Setting Gi: 82225292
Created: 16-Dec-2008
Updated: 17-Jan-2013
Structure
?
Program:
Drawing:
Aligned Rows:
 
ligand bindingcoactivator
Conserved site includes 17 residues -Click on image for an interactive view with Cn3D
Feature 1:ligand binding site [chemical binding site]
Evidence:
  • Structure:2AX9_a; human androgen receptor binds to Nonsteroidal Agonist R-3, contacts at 4A
    View structure with Cn3D

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                    #  ## ##  #                             ##  ##  #  
2AX9_A        9 IFLNVLEAIEPGVVCAGHDNNQPDSFAALLSSLNELGERQLVHVVKWAKALPGFRNLHVDDQMAVIQYSWMGLMVFAMGW 88
gi 46576435 530 IFLNVLEAIEPMVVCSGHDNNQPDSFALLLSSLNELGERQLVHVVKWAKALPGFRNLHVNDQMTVIQYSWMGLMIFAMGW 609
gi 82213368  86 IFLNVLEAIEPGVVCAGHDNSQPDSFSNLLSSLNELGERQLVYVVKWAKALPGFRNLHVDDQMSIIQYSWMGLMVFAMGW 165
gi 82225292 602 MFLNILEAIEPEVVNAGHDYGQPDSAASLLTSLNELGERQLVKVVKWAKGMPGFRSLYVDDQMTVIQHSWMAVMVFALGW 681
1XJ7_A       10 IFLNVLEAIEPGVVCAGHDNNQPDSFAALLSSLNELGERQLVHVVKWAKALPGFRNLHVDDQMAVIQYSWMGLMVFAMGW 89
1T73_A       22 IFLNVLEAIEPGVVCAGHDNNQPDSFAALLSSLNELGERQLVHVVKWAKALPGFRNLHVDDQMAVIQYSWMGLMVFAMGW 101
1T5Z_A        4 IFLNVLEAIEPGVVCAGHDNNQPDSFAALLSSLNELGERQLVHVVKWAKALPGFRNLHVDDQMAVIQYSWMGLMVFAMGW 83
1XOW_A        2 IFLNVLEAIEPGVVCAGHDNNQPDSFAALLSSLNELGERQLVHVVKWAKALPGFRNLHVDDQMAVIQYSWMGLMVFAMGW 81
2Q7K_A       10 IFLNVLEAIEPGVVCAGHDNNQPDSFAALLSSLNELGERQLVHVVKWAKALPGFRNLHVDDQMAVIQYSWMGLMVFAMGW 89
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1       #           #               #      #                                            
2AX9_A       89 RSFTNVNSRMLYFAPDLVFNEYRMHKSRMYsqCVRMRHLSQEFGwLQITPQEFLCMKALLLFSIIPVDGLKnQKFFDELR 168
gi 46576435 610 RSFKNVNSRMLYFAPDLVFNEYRMHKSRMYsqCVRMRHLSQEFGwLQVTPEEFLCDEGPSALSIIPVEGLKdQKCFDELR 689
gi 82213368 166 RSFTNVNSRMLYFAPDLVFNEYRMHKSRMYsqCIRMRHLSQEFGwLQITPQEFLCMKALLFFSIIPVDGLKnQKLFDELR 245
gi 82225292 682 RSFKNVKSRMLYFAPDLVFNEHRMQVSTMYehCIRMKNFSQEFAmLQVSQEEFLCMKALLLFSTIPVEGLKgQNFFDELR 761
1XJ7_A       90 RSFTNVNSRMLYFAPDLVFNEYRMHKSRMYsqCVRMRHLSQEFGwLQITPQEFLCMKALLLFSIIPVDGLKnQKFFDELR 169
1T73_A      102 RSFTNVNSRMLYFAPDLVFNEYRMHKSRMYsqCVRMRHLSQEFGwLQITPQEFLCMKALLLFSIIPVDGLKnQKFFDELR 181
1T5Z_A       84 RSFTNVNSRMLYFAPDLVFNEYRMHKSRMYsqCVRMRHLSQEFGwLQITPQEFLCMKALLLFSIIPVDGLKnQKFFDELR 163
1XOW_A       82 RSFTNVNSRMLYFAPDLVFNEYRMHKSRMYsqCVRMRHLSQEFGwLQITPQEFLCMKALLLFSIIPVDGLKnQKFFDELR 161
2Q7K_A       90 RSFTNVNSRMLYFAPDLVFNEYRMHKSRMYsqCVRMRHLSQEFGwLQITPQEFLCMKALLLFSIIPVDGLKnQKFFDELR 169
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                #   #                                  
2AX9_A      169 MNYIKELDRIIackrknptSCSRRFYQLTKLLDSVQPIARELHQFTFDLLiks--hmvSVDFPEMMAEIISVQVPKILSG 246
gi 46576435 690 MNYIKELDRVIsckrnnpaSSSPRFFNLPKLLGSVQPIDVNLVQFTFGLFgka--qmvSVDFPEMMSEIISVQVPKILSG 767
gi 82213368 246 MNYIKELDRIIackrknptSCSRRFYQLTKVLDSVHPIAKDLHQFTFDLLika--hmvSVDYPEMMAEIISVQVPKILSG 323
gi 82225292 762 RSYINELDRLVsfr--sksSCSERFQQLTRLLDSLQPVLKKLHQFTFDLFvqsqnlsnQVCFPEMISEIISVHVPKILAG 839
1XJ7_A      170 MNYIKELDRIIackrknptSCSRRFYQLTKLLDSVQPIARELHQFTFDLLiks--hmvSVDFPEMMAEIISVQVPKILSG 247
1T73_A      182 MNYIKELDRIIackrknptSCSRRFYQLTKLLDSVQPIARELHQFTFDLLiks--hmvSVDFPEMMAEIISVQVPKILSG 259
1T5Z_A      164 MNYIKELDRIIackrknptSCSRRFYQLTKLLDSVQPIARELHQFTFDLLiks--hmvSVDFPEMMAEIISVQVPKILSG 241
1XOW_A      162 MNYIKELDRIIackrknptSCSRRFYQLTKLLDSVQPIARELHQFTFDLLiks--hmvSVDFPEMMAEIISVQVPKILSG 239
2Q7K_A      170 MNYIKELDRIIackrknptSCSRRFYQLTKLLDSVQPIARELYQFTFDLLiks--hmvSVDFPEMMAEIISVQVPKILSG 247

                ....*...
Feature 1               
2AX9_A      247 KVKPIYFH 254
gi 46576435 768 RVKPLYFH 775
gi 82213368 324 KVKPIYFH 331
gi 82225292 840 TVKPILFH 847
1XJ7_A      248 KVKPIYFH 255
1T73_A      260 KVKPIYFH 267
1T5Z_A      242 KVKPIYFH 249
1XOW_A      240 KVKPIYFH 247
2Q7K_A      248 KVKPIYFH 255

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap