2AA6,2AA2,2A3I,2OAX,1Y9R,2ABI


Conserved Protein Domain Family
NR_LBD_MR

?
cd07075: NR_LBD_MR 
Click on image for an interactive view with Cn3D
Ligand binding domain of the mineralocorticoid receptor, a member of the nuclear receptor superfamily
The ligand binding domain of the mineralocorticoid receptor (MR): MR, also called aldosterone receptor, is a member of nuclear receptor superfamily involved in the regulation of electrolyte and fluid balance. The receptor is activated by mineralocorticoids such as aldosterone and deoxycorticosterone as well as glucocorticoids, like cortisol and cortisone. Binding of its ligand results in its translocation to the cell nucleus, homodimerization and binding to hormone response elements (HREs) present in the promoter of MR controlled genes. This results in the recruitment of the coactivators and the transcription of the activated genes. MR is expressed in many tissues and its activation results in the expression of proteins regulating electrolyte and fluid balance. Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, MR has a central well conserved DNA binding domain (DBD), a variable N-terminal domain, a flexible hinge and a C-terminal ligand binding domain (LBD ). The LBD, in addition to binding ligand, contains a ligand-dependent activation function-2 (AF-2).
Statistics
?
PSSM-Id: 132760
View PSSM: cd07075
Aligned: 10 rows
Threshold Bit Score: 501.393
Threshold Setting Gi: 47217367
Created: 16-Dec-2008
Updated: 17-Jan-2013
Structure
?
Program:
Drawing:
Aligned Rows:
 
ligand bindinghomodimercoactivator
Conserved site includes 15 residues -Click on image for an interactive view with Cn3D
Feature 1:ligand binding site [chemical binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                        ## ##  #                              #  #   #  
2AA6_A        28 SPVMVLENIEPEIVYAGYDSSKPDTAENLLSTLNRLAGKQMIQVVKWAKVLPGFKNLPLEDQITLIQYSWMSLLSFALSW 107
gi 115529242 734 SPVKILESIEPEIVYAGYDSSKPDTAEYLLSTLNRLAGKQMIQVVKWAKILPGFRNLPLEDQITLIQYSWMCLSSFALSW 813
2AA2_A        28 SPVMVLENIEPEIVYAGYDSSKPDTAENLLSTLNRLAGKQMIQVVKWAKVLPGFKNLPLEDQITLIQYSWMSLSSFALSW 107
2A3I_A         6 SPVMVLENIEPEIVYAGYDSSKPDTAENLLSTLNRLAGKQMIQVVKWAKVLPGFKNLPLEDQITLIQYSWMSLSSFALSW 85
2OAX_A         9 SPVMVLENIEPEIVYAGYDSSKPDTAENLLSTLNRLAGKQMIQVVKWAKVLPGFKNLPLEDQITLIQYSWMCLLSFALSW 88
1Y9R_A         8 SPVMVLENIEPEIVYAGYDSSKPDTAENLLSTLNRLAGKQMIQVVKWAKVLPGFKNLPLEDQITLIQYSWMCLLSFALSW 87
2ABI_A         9 SPVMVLENIEPEIVYAGYDSSKPDTAENLLSTLNRLAGKQMIQVVKWAKVLPGFKNLPLEDQITLIQYSWMCLSSFALSW 88
gi 2500914   365 SAAVILENIEPEIVYAGYDNTQPDTAENLLSSLNQLAGKQMVQVVKWAKVIPGFRNLPLEDQITLIQYSWMCLSSFALSW 444
gi 30315969  112 SICSVLELIEPEVVFAGYDNTQPDTTDHLLSSLNQLAGKQMIRVVKWAKVLPGFRGLPIEDQITLIQYSWMCLSSFSLSW 191
gi 47217367  173 SICSILELIEPEEVYSGYDNTQPDTTDHLLSSLNRLAGKQMVRMVKWAKVLPGFRGLPIEDQITLIQYSWMCLSSFCLSW 252
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1        #           #               #      #                                            
2AA6_A       108 RSYKHTNSQFLYFAPDLVFNEEKMHQSAMYELCQGMHQISLQFVRLQLTFEEYTIMKVLLLLSTIPKDGLKS-------- 179
gi 115529242 814 RSYKHTNSQFLYFAPDLIFDEERMRQSAMFELCQGMHQISLQFVRLQLSFEEYTIMKVLLLLSTVPKDGLKS-------- 885
2AA2_A       108 RSYKHTNSQFLYFAPDLVFNEEKMHQSAMYELCQGMHQISLQFVRLQLTFEEYTIMKVLLLLSTIPKDGLKS-------- 179
2A3I_A        86 RSYKHTNSQFLYFAPDLVFNEEKMHQSAMYELCQGMHQISLQFVRLQLTFEEYTIMKVLLLLSTIPKDGLKS-------- 157
2OAX_A        89 RSYKHTNSQFLYFAPDLVFNEEKMHQSAMYELCQGMHQISLQFVRLQLTFEEYTIMKVLLLLSTIPKDGLKS-------- 160
1Y9R_A        88 RSYKHTNSQFLYFAPDLVFNEEKMHQSAMYELCQGMHQISLQFVRLQLTFEEYTIMKVLLLLSTIPKDGLKS-------- 159
2ABI_A        89 RSYKHTNSQFLYFAPDLVFNEEKMHQSAMYELCQGMHQISLQFVRLQLTFEEYTIMKVLLLLSTIPKDGLKS-------- 160
gi 2500914   445 RSYKHASSQFLYFAPDLIFNEERMRQSAMYDLCQGMQQISLEFSRLQLTFEEYTLMKVLLLLSTVPKDGLKC-------- 516
gi 30315969  192 RSYKHTNGQMLYFAPDLVFNEDRMQQSAMYDLCLGMRQVSQEFVRLQLTYQEFLSMKVLLLLSTVPKEGLKN-------- 263
gi 47217367  253 RSYKHTNGQMLYFAPDLIFNEERMRQSAMYDLCLGMRQVSQEFLRLQLSYDEFLSMKVLLLLSTGLGRLTLFgfhcskql 332
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                             ##  #      
2AA6_A       180 -----------------QAAFEEMRTNYIKELRKMVTKCPNNSGQSWQRFYQLTKLLDSMHDLVSDLLEFCFYTFRES-- 240
gi 115529242 886 -----------------QAAFEEMRANYIKELKKMVTKCPSNSGQSWQRFYQLTKLLDSMHDLVSDLLEFCFYTFRES-- 946
2AA2_A       180 -----------------QAAFEEMRTNYIKELRKMVTKCPNNSGQSWQRFYQLTKLLDSMHDLVSDLLEFCFYTFRES-- 240
2A3I_A       158 -----------------QAAFEEMRTNYIKELRKMVTKCPNNSGQSWQRFYQLTKLLDSMHDLVSDLLEFCFYTFRES-- 218
2OAX_A       161 -----------------QAAFEEMRTNYIKELRKMVTKAPNNSGQSWQRFYQLTKLLDSMHDLVSDLLEFCFYTFRES-- 221
1Y9R_A       160 -----------------QAAFEEMRTNYIKELRKMVTKAPNNSGQSWQRFYQLTKLLDSMHDLVSDLLEFCFYTFRES-- 220
2ABI_A       161 -----------------QAAFEEMRTNYIKELRKMVTKAPNNSGQSWQRFYQLTKLLDSMHDLVSDLLEFCFYTFRES-- 221
gi 2500914   517 -----------------QAAFEEMRVNYIKELRKVLLKSPHNSGQSWQRYFQLTKLLDSMQDLVGDLLEFCFYTFRES-- 577
gi 30315969  264 -----------------QAAFEEMRVNYIKELRRSVGKAPTTLDRRGNRSSQLTKLLDAMHDLGGELLDFCFYTFRES-- 324
gi 47217367  333 ppspphmrtvpkeglknQAAFEEMRLNYIKELRRSVGKATNNSGQTWQRFFQLTKLLDAMHDVSTLCLPRHAAPLGRPhd 412
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
2AA6_A       241 ------------------------------------------------------HALKVEFPAMLVEIISDQLPKVESGN 266
gi 115529242 947 ------------------------------------------------------QALKVEFPAMLVEIISDQLPKVESGN 972
2AA2_A       241 ------------------------------------------------------HALKVEFPAMLVEIISDQLPKVESGN 266
2A3I_A       219 ------------------------------------------------------HALKVEFPAMLVEIISDQLPKVESGN 244
2OAX_A       222 ------------------------------------------------------HALKVEFPAMLVEIISDQLPKVESGN 247
1Y9R_A       221 ------------------------------------------------------HALKVEFPAMLVEIISDQLPKVESGN 246
2ABI_A       222 ------------------------------------------------------HALKVEFPAMLVEIISDQLPKVESGN 247
gi 2500914   578 ------------------------------------------------------QALKVEFPAMLVEIISDQLPKVESGI 603
gi 30315969  325 ------------------------------------------------------QALKVEFPEMLVEIISDQIPKVESGN 350
gi 47217367  413 ttgfppsfqesphlhtqskkaaqtpcetaskymceysklvgnlldfcfytfresQVLKVEFPEMLVEIISDQIPKVESGL 492

                 ....*....
Feature 1                 
2AA6_A       267 AKPLYFHRK 275
gi 115529242 973 AKPLYFHRK 981
2AA2_A       267 AKPLYFHRK 275
2A3I_A       245 AKPLYFHRK 253
2OAX_A       248 AKPLYFHRK 256
1Y9R_A       247 AKPLYFHRK 255
2ABI_A       248 AKPLYFHRK 256
gi 2500914   604 AKPLYFHRK 612
gi 30315969  351 THTLYFHKK 359
gi 47217367  493 THTIYFHKK 501

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap