Conserved Protein Domain Family
ALDH_SGSD_AstD

?
cd07095: ALDH_SGSD_AstD 
N-succinylglutamate 5-semialdehyde dehydrogenase, AstD-like
N-succinylglutamate 5-semialdehyde dehydrogenase or succinylglutamic semialdehyde dehydrogenase (SGSD, E. coli AstD, EC=1.2.1.71) involved in L-arginine degradation via the arginine succinyltransferase (AST) pathway and catalyzes the NAD+-dependent reduction of succinylglutamate semialdehyde into succinylglutamate.
Statistics
?
PSSM-Id: 143414
View PSSM: cd07095
Aligned: 19 rows
Threshold Bit Score: 541.092
Threshold Setting Gi: 196230845
Created: 30-Oct-2008
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
 
Feature 1:catalytic residues [active site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
gi 75521601   38 QVGQACRAARAAFPRWARlSFAERQAVVERFAGLLERNKGELTAIIARETGKPRWEAATELTAMINKIAISIKAYhvRTG 117
gi 81601322   47 EIANACYVAHRALKSWANtSFEERARYTKAFVEQVEKNRDQLARLISLETGKPLWESQTEVSSVIGKVNLSIQAYqeRTW 126
gi 94502055   42 QVKQAVAAAKQAQTEWALlGREKRVEITQRFATLLKENQTELARTISDETGKPTWEALTEVTAMANKVAISITAQdtRAS 121
gi 81621248   27 SIDAACHSARAAFAEWAMtPLAERRAIALRFAETVRARREEIATLIARETGKPMWEALTEADSVAAKVAISIRAQdeRAG 106
gi 118572897  23 DVDAEVEIARRAWPEWAAkPVTFRTETLRRFADRVKAESEAFADLIARETGKPLWEARTEVESVANKVDISVKAYaeRTP 102
gi 56552168   30 DVDQAVSRARSVLSGWAKtALEDRIVILERFAAIIREKADIFGSIIARETGKPFWEAKTEAQIVANKVDISILAYkdRSY 109
gi 189081229  40 EVAAAVEAARKAFPAWADrSREERIAVLRRYKDVLVARTGTFAEALSRETGKALWETKAELGSMAGKVEASIKAYdeRTG 119
gi 83858635   40 IVKEAFGSSRAAFGEWALtPYEERRAVVEAYGDIVKAEADHIAQLISRETGKPLWETKGEAGAMAAKVGVSIAAHdeRAG 119
gi 114799206  40 DVKAAVASAQAAFSGWARtPVAERISILERYAEELGKRAGEIAEAISRDMGKALWDSQAEAATMKAKIAVSVAALkeRAG 119
gi 87311803   37 DVDDAFLAAVEAQIPWSAlPWEERATSLRAFAGAVRANRDAMTQAISAEVGKPLWDAATEVDAVAAKIEVTINAQqrRRP 116
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                     #                                                  
gi 75521601  118 EQRSemp--dgAASLRHRPHGVLAVFGPYNFPGHLPNGHIVPALLAGNTIIFKPSElTPWSGEAVMRLWQqaGLPPGVLN 195
gi 81601322  127 PKQTeta--eaNACLRFKPHGVVVVLGAFNFPAHLSNGHIVPALLAGNTVLYKPSEhTPAVAELIIQCWHdsGLPPGVIN 204
gi 94502055  122 TGNAytg-dnkNLHLTHRPHGVMAVYGPYNFPGHLPNGHIVPALLAGNTIVFKPSEeTPKTAEESIKIWQeaGLPKGVIN 200
gi 81621248  107 ERSEpma--daTARLAHRPHGVLAVIGPFNFPMHLANGHIVPALLAGNAVVFKPSEkTPACGQLMGELWRaaGLPDHVLT 184
gi 118572897 103 NRRIega-mglRSAVRHKPHGALAVLGPYNFPAHLPNGHIVPALIAGNSVVFKPSEkTPAVGAKLVELLHsaGVPQEVLR 181
gi 56552168  110 PVALpdiapniKSGISYKPHGVLAVLGPFNFPAHLPNGHIVPALIAGNVIIFKPSEkTPASGEFLVQCYHeaGVPKEVVQ 189
gi 189081229 120 EHANdma--fgRAVLRHRAHGVMAVLGPFNFPGHLPNGHIVPALLAGDTVVFKPSEeTPLAGQLLVEALEeaGVPAGVIN 197
gi 83858635  120 RKVTete--fgEAVLDHKPLGVMFVLGPYNFPGHLPNGHIIPALLAGNTVVFKPSElTPAVGEFMVQCWEkaGLPAGVLN 197
gi 114799206 120 ERDEpaa--fgQSRLTHRPHGVMAVFGPFNFPGHLPNGHIVPALLAGNTCVFKPSElAPSVARLMADAFEaaGLPPGCLN 197
gi 87311803  117 EETLdln--grIGRTWYRPLGVVAVYGPFNFPAHIANGQIVPALLAGNSVLFKPSElTPQVAELTTKLWNeaGLPPGVFN 194
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                       #                              # 
gi 75521601  196 LVQGGCetGQALSALedLDGLLFTGSANTGYQLHRQLSgqPEKILALEMGGNNPLIIDEVaDIDAAVHLTIQSAFVTaGQ 275
gi 81601322  205 CLQGNAncGNTLLSQd-IQGVYFTGSYATGLRIHQQFCnrPEIILALEMGGNNPLVIDEVkDIDAAVYHTMLSTMITaGQ 283
gi 94502055  201 LVQGAKevGVALGQAe-IDGLLFTGSSTTGKILHKQFAgkPEVLLALEMGGNNPLIVNDNiNVNNTVNVILQSAFLSaGQ 279
gi 81621248  185 IVIGGGeaGEALVRHeaLDGVLFTGGVQAGRAIHRALAdaPHKILALELGGNAPLVVWDVaDIEAAAHLIVQSAYVTaGQ 264
gi 118572897 182 LVVGGPdtGKALAAHpgIDGLLFTGSARTGLALNRQFAgqPGKMLALEMGGNNPIVAWDTaDIRTAAILIVQSAFLSaGQ 261
gi 56552168  190 LLIGGRteGEALSRHngIDGLLFTGSSQGGVALSRVFAenPGRILALEMGGNNPLVIWNSeDIESAAAIAVQSAYLSaGQ 269
gi 189081229 198 LVQGGRevGQALIDQe-IDGLLFTGSAAAGAFFRRHFAdrPDVILALELGGNNPLVVWDAgDPEAVAALIVQSAFITtGQ 276
gi 83858635  198 LVQGARetGAAALDDpeLDGVLFTGSWNTGSFIHKKFAgrTGVQLALEMGGNNPLVVWDAaDAEAAARIAVLSSYITaGQ 277
gi 114799206 198 IVHGGRdtGAALIDQp-INGLLFTGSAATGVFFHKHFAgrPEVILALEMGGNNPLIVWEPaDVDAAADIAAQSAYLTtGQ 276
gi 87311803  195 LLQGGAatGRLIAEHadLRGLFFTGSLTTGLKLRETLVhrPEVLLALELGGNNPLVVLEPdQNLSMLNQVIQSAFLTsGQ 274
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1         #                                                                              
gi 75521601  276 RCTCARRVLLKsgaqGDAFLARLVAVSQRLTPGNWDDep-qPFIGGLISEQAAQQVFTAWQQLeamGGRTLLAPRLLqa- 353
gi 81601322  284 RCTCARRIIVPdsqtGDLFLERFAKACKLMRIGSFDSqp-ePFIGPVISHVQALKHLHAQKQLvemGGEIILPMSLLve- 361
gi 94502055  280 RCTCARRLIVIegsnTDKLLIALKEKAAQLIADHPDAdpepFMGPVINANTKQALLKAQQDLIa-kGGKALLEMTALde- 357
gi 81621248  265 RCTCARRLILPegarGDALLEALTMLMDRLVIGGPFQsp-aPFMGPVIDAHAAAQVLAAQDRMtadGGRPLRLAAVRea- 342
gi 118572897 262 RCSNARRLIVKds-lADALIAEVRELANRLIVDHPHAdp-aPYMGPVIDNEAADGLTESFLVLmsnGGQVIRHMTRPva- 338
gi 56552168  270 RCTCARRLIVEdg-kHQPLLDAIQRLIGRLIIDQPFAdpqpFMGSVIDNAAADHAEKAYNDLVa-nGAKILHPLHRLeq- 346
gi 189081229 277 RCSCARRLIVSddaaGRAVIDAVAALSERLVIGPWNGgq-ePFMGPLISDRAAAMALAGAKAM---PGQTLRAMTSVdgl 352
gi 83858635  278 RCSCARRLILPqgaaGDAVVEQLVGMIGKLSVNVWNAdpepFMGPLVSAQAAANVLKAQDELIa-lGARPIVKSEAMal- 355
gi 114799206 277 RCSCARRLILPngafGDKVLEAIIARAKGIEVGAWDEpg-iFMGPLVSHTAASQAVAFYEMLLs-kGAASLLPLEAGpq- 353
gi 87311803  275 RCTCVRRLILVg--eSAAFLQQLQEKTSQIAVGAADAnpepFMGPLIHAAAAERILSQQQRLVa-gGAVPILESRRMps- 350
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
gi 75521601  354 gTSLLTPGIIEMTgvaGVPDEEVFGPLLRVWRYDsFEEAIRMANNTRFGLSCGLVSPerEKFDQLLLeARAGIVNWNKPL 433
gi 81601322  362 yTGLISPGIIDMTrakNPPDEEIFAPFAQIYRYNhFDEAIQLANQTRYGLSAGLLSDnkDHYLQFYQhIRAGLINWNRPT 441
gi 94502055  358 tSNLLTPAILDMTdakDVPDEEWFGPLLQVYRVNdFSMAMKLANDTQYGLSAGLISDdaTQQNQFLNtIRAGVVSINQPT 437
gi 81621248  343 rSALLSPGLIELTd-aPLRDEEIFGPLLQVRRAAdFDAALALANATRFGLAAGLISDdeALYRRFWTsVRAGIVNWNRPT 421
gi 118572897 339 gRPFLTPGIIDVTtmaERPDVELFGPLLQVIRVEtFEAAIAEANNTAFGLSAALIGGtpQLYDQFWAnARAGVINWNRPT 418
gi 56552168  347 dKPFLTPALLDMTdcaDKVDEEIFAPVLKVIRVSdFEAAIKEANNTRFGLSAALVDDspEDFMRFRDeVRAGVINWNRPT 426
gi 189081229 353 sRAFVSPGLVDVTg-eTVPDEELFAPLLQVRRVGsFEEAIAAANATRYGLSAGLVSNetAHWDRFLTrIRAGVVNWNRPT 431
gi 83858635  356 gDAFVSPGLLDVDg-vDTPDEEVFGPLLQVRRADsFEAALKEANNTAYGLSAGLVSDseDLWKQFWAgSRAGIVNRNRPT 434
gi 114799206 354 gTGFVSPGVVDVTearDVPDEELFGPLIQIVRVAsFDEAIARANASRYGLSGGLVSDddALWARAYSeMRAGILNRNRPT 433
gi 87311803  351 gPAFLSPGLIDVTtcgSRSDEEMFGPLLQVIRVDdFSAAIREANQTRFGLVAGLLGGghDDFQRFRRqVNAGLVNWNLPT 430
                        410       420       430
                 ....*....|....*....|....*....|....*.
Feature 1                                            
gi 75521601  434 TGAASTAPFGGIGASGNHRPSAWYAADYCAWPMASL 469
gi 81601322  442 TGAASSLPFGGVGCSGNHRPSAYFAADYCAYPVASM 477
gi 94502055  438 AGASSELPFGGVGLSGNHRASALYAADYCAWPQSLM 473
gi 81621248  422 TGASSAAPFGGVGGSGNHRPSAYYAADYSAYPVAGL 457
gi 118572897 419 NGASSAAPFGGVGLSGNHRPSAFYAADYCAYPVASA 454
gi 56552168  427 NGAPSTAPFGGVGLSGNHRPSAYFAADYCAYPVTST 462
gi 189081229 432 TGAAGTMPFGGLGNSGNHRPSAYYAADYCAYPVASF 467
gi 83858635  435 PGAASTMPFGGPGQSGNLRPSAYYAADYVAYPVATQ 470
gi 114799206 434 AGASGAMPFGGPGLSGNFRPGAYYAADYCAWPQASQ 469
gi 87311803  431 TGASGRLPFGGMGQSGNYRPAGYFATDFCNIPVAGL 466

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap