Conserved Protein Domain Family
ALDH_PADH_NahF

?
cd07113: ALDH_PADH_NahF 
Escherichia coli NAD+-dependent phenylacetaldehyde dehydrogenase PadA-like
NAD+-dependent, homodimeric, phenylacetaldehyde dehydrogenase (PADH, EC=1.2.1.39) PadA of Escherichia coli involved in the catabolism of 2-phenylethylamine, and other related sequences, are present in this CD. Also included is the Pseudomonas fluorescens ST StyD PADH involved in styrene catabolism, the Sphingomonas sp. LB126 FldD protein involved in fluorene degradation, and the Novosphingobium aromaticivorans NahF salicylaldehyde dehydrogenase involved in the NAD+-dependent conversion of salicylaldehyde to salicylate.
Statistics
?
PSSM-Id: 143431
View PSSM: cd07113
Aligned: 6 rows
Threshold Bit Score: 862.133
Threshold Setting Gi: 2506352
Created: 14-Dec-2008
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
 
Feature 1:catalytic residues [active site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
gi 2506352    21 GLYIDGRPGPAQSEKrlaIFDPATGQEIASTADaneaDVDNAVMSAWRAFVSrrwagrLPAERERILLRFADLVEQHSEE 100
gi 193077462  19 GHFIDGKLVAAELLDkvdIVNPSTEQVVAQISIgsqqDVESAVKSAEHAFQNawa-etTPYERGVKLNKLADLIEQHGEE 97
gi 171316036  19 GHYIDGRAVAGRGERi-dVRDPATRAVIGSVAQatddDVEAAIASSHRAFRSewa-nrTPADRERILLRFADLIEAHGEE 96
gi 167567912  19 AHFVGGASRAGASDHriaITNPATEQTIAHVRNadaaDVDAAVAAAKAAFHGawr-dtSAGRRAEILNRLADLIEQHGEE 97
gi 152998027  19 GQFINGQTKASGDNTf-dIINPSTEAVIAKIHSattqEVDAAIESSYQVFKGawg-ktSPYIRGVVLNKLADLIEQNGEE 96
gi 16766429   19 GQFIAGERQAGNGTNf-sVTNPATGKIIADVVSatpaQAEEAMQSARRAFDVwr--kmPTLQRGALLLKLADTLAAHREE 95
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                 #      
gi 2506352   101 LAQLETLEQGKsiaISRAFEVGCTLNWMRYTAGLTTKIaGKTLDlsiplpqgarYQAWTRKEPVGVVAGIVPWNFPLMIG 180
gi 193077462  98 LAQLETLSTGKlinISRHLEVAQSVIFLRYFAGWATKInGQTMQpsipsmqgekYTAFTLRQPVGVVAGIVPWNFSLMIG 177
gi 171316036  97 IAQIETAQSGKligLSRVIEVGWSARWLRYYAGWATKIaGETLApsfpgmngerYTSFTLREPLGVVFGIIPWNFPVMIP 176
gi 167567912  98 IAQLETLCSGKhihVSRAIEVAQSATFLRYYAGWATKInGETIApslpsragerYTALTFREPVGVVAGIVPWNFSVMIA 177
gi 152998027  97 IAQLETLCSGKsihLSRMFEVQQSAMFLRYFAGWSTKInGETMTpsfpsmqgeeYSAFTRREAIGVVAGILPWNFSVMIA 176
gi 16766429   96 LAQLESVCSGKtimLSRGLELDQSVAFLRYFAGWAGKItGETLNvslpsmgeerYTAFTQRQPIGVVVGIVPWNFSIMIA 175
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
gi 2506352   181 MWKVMPALAAGCSIVIKPSEtTPLTMLRVAELASEAGIPDGVFNVVTGSGavcGAALTSHPhVAKISFTGSTATGKGIAR 260
gi 193077462 178 VWKIGSALTTGCTIVLKPSEfASLSLLRLAELAIEAGIPAGVINVVTGKGe-tGQYLIESPlVKKVSFTGSVPTGIAIGK 256
gi 171316036 177 VWKFGAALATGNTVLIKSSEfTPLTMLRIAELATEAGLPAGALNVINGTGq-vGAKVIGDPrVAKVSFTGSVPTGRIIGE 255
gi 167567912 178 IWKIASALVTGCTVVIKPSEfSPLTLLRLAELATEAGVPPGALNVVNGDGn-vGRMLIDHAdVAKVSFTGSVATGIRVGT 256
gi 152998027 177 CWKIGAALCTGCTIVLKPSEfTPLTILRIAELAKEAGVPDGVLNIVNGKGd-vGGQLIQHPkVRKVSFTGSVATGKKISA 255
gi 16766429  176 IWKLAAALVCGCTIVIKPSEyTPLTLLRVAELAKEAGFPDGVINVVNGAGgeiAQQLIAHPdCAKVSFTGSVATGEKVRR 255
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                    #                              #  #                                 
gi 2506352   261 TAAd-hLTRVTLELGGKNPAIVLKDADPQWVIEGLMTGSFLNqGQVCAASSRIYIEaplFDTLVSGFEQAVKSLQVGPGM 339
gi 193077462 257 LAMssdLTRVSLELGGKNAIAVLADANIDEILPTLLQATFVHqGQVCASPERFFVHrtkYDELVDKLSKALSQFKIGSAM 336
gi 171316036 256 QAVnanLTRFTLELGGKNAAAFLADTPVDKILDGIVEAGFLHsGQVCASAERFFVHrskFDEVVEKMKARLDSFQPADPM 335
gi 167567912 257 QAIganLTRATLELGGKNAAGFLEDVDVDDAVSGLLTAGYTHqGQICASPERVYVHrskLDEVLEKVKTGLQAIRVGSPL 336
gi 152998027 256 AASa-dLTRCTLELGGKNTAAILKDADIDRVVGGLFQLGYIHqGQVCAAPERVYVHssrIDELTTKLAQKLSEAKIGSPL 334
gi 16766429  256 SATs-sGKRVTLELGGKNAALFLNDLTAQAMVNGILEAGYLNqGQICAAAERFYLPqekLDTVMTLLRQRLSEIVPGSPL 334
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
gi 2506352   340 SPVAQINPLVSRAHCDKVCSFLDDaqaqQAELIRGSNGpageGYYVAPTLVVNpdakLRLTREEVFGPVVNLVRVAdGEE 419
gi 193077462 337 DEGSMFGPLSNQPHFHKVKHYLDMak-aNNQIIAGGEAldqtGYFVQPTLISFkntdDPLFSEETFGPVVGVMPFEtDEE 415
gi 171316036 336 DDAGMIGPVCNEPQFRKCVDAFDLaraeGDTIVTGGGAyardGFYVKPTIVLPrsleSASYRKEIFGPVGAFVPFDdEEE 415
gi 167567912 337 DESVAFGPLANKPHLDKILGYFDWar-eNGEVVFGGRRvdrpGYFVEPTAVLAkhrdDRLLHEETFGPVISFLPYDtDDE 415
gi 152998027 335 DESVYFGPLSNEPQFNKVCEYLEIah-kESRVLHGGKAisgkGFFVEPTIVQAssvdETLMQEETFGPIISFMPYEdEEE 413
gi 16766429  335 DEKTVMGPLANQVQLEKVLRLIQRareeGDTIVYGGETlpgeGYFLQPTAVKVrsknSTLMHEETFGPVCSFIGYQnEKE 414
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
gi 2506352   420 ALQLANDTEYGLTASVWTQNLSQALEYSDRLQAGTVWVNSHTLIDANLPFGGMKQSGTGRDFGPDWLDGWCETKSVCVRY 499
gi 193077462 416 LIQLMNQSRFGLTASIWTNDLSKALRLIPKIEAGTLWVNMHTFLDPSVPFGGVKASGIGREFSDAFIEDYTELKSVMIRY 495
gi 171316036 416 LIAMINDTPFGLTASLWTNDLSKALRYVPRIEAGTVWVNMHTLVDPAVPFGGAKGSGVGREYGSSFIDAYTEPKAVTIRF 495
gi 167567912 416 LVSLFNDTPFGLTASLWTNNLSKALRLIPRIEAGTLWVNMHTFLDPAVPFGGVKSSGLGREFGSAFIHDYTELKSVMIRY 495
gi 152998027 414 LIDLINNTPFGLSSSIWTNNLSQAMRMIPKIESGTVWVNMHSILDPSVPFGGTKQSGVGREFGREFINDYTEVKSVIMCY 493
gi 16766429  415 ALSHINDSPFGLAASVWSENISKALRYAEDIDAGMVWVNMHTFLDPAVPFGGMKGSGIGREFGSAFIDDYTELKSVMVRY 494

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap