Conserved Protein Domain Family
ALDH_F4-17_P5CDH

?
cd07123: ALDH_F4-17_P5CDH 
Delta(1)-pyrroline-5-carboxylate dehydrogenase, ALDH families 4 and 17
Delta(1)-pyrroline-5-carboxylate dehydrogenase (EC=1.5.1.12 ), families 4 and 17: a proline catabolic enzyme of the aldehyde dehydrogenase (ALDH) protein superfamily. Delta(1)-pyrroline-5-carboxylate dehydrogenase (P5CDH), also known as ALDH4A1 in humans, is a mitochondrial homodimer involved in proline degradation and catalyzes the NAD + -dependent conversion of P5C to glutamate. This is a necessary step in the pathway interconnecting the urea and tricarboxylic acid cycles. The preferred substrate is glutamic gamma-semialdehyde, other substrates include succinic, glutaric and adipic semialdehydes. Also included in this CD is the Aldh17 Drosophila melanogaster (Q9VUC0) P5CDH and similar sequences.
Statistics
?
PSSM-Id: 143441
View PSSM: cd07123
Aligned: 30 rows
Threshold Bit Score: 861.123
Threshold Setting Gi: 67904582
Created: 11-Dec-2008
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
 
Feature 1:NAD binding site [chemical binding site]
Evidence:
  • Comment:based on similarity to structure 2BJA: 1-Pyrroline-5-Carboxylate Dehydrogenase with bound NAD from Thermus thermophilus.

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
gi 62511241   32 VANEPVLAFTQGsp--eRDALQKALKDLKg-rMEAIPCVVGDEevwTSDVQYQVSPFn-HGHKVAKFCYad-ksLLNKAI 106
gi 67904582    9 PGNADGLSYGPGsa--eRDLLKSALAEMEs-vVTDIPSIINGEriyTGRKGKQANPWnnHGQPLAEYYEvdsntVTEKAI 85
gi 2494072    14 VSNEPMLSYAPGsp--eRAGLQAALAEMQsqlPFEVPCIINGQevrTNNIQKQPMPHd-HARHLCTFHEgs-peLVEKAT 89
gi 146345498  35 IDNEPNKHYAAGsp--dRKALQEALARTQrnaPLSVPLVIAGKevkSSSSLTQSNPA--SHGPVATYSNat-akDVQAAI 109
gi 115384268  39 FVNEQPLDYAKGsp--eRAKLTQALEKLKgelPVQVPIQISGStvaTHGSRKQENPSr-HREIVAEYATag-peQVNAAV 114
gi 17534447   32 KTNEPILEYRKGsk--eRQDLEAALAFYSk-nITEVPLRIGDKkitNKLEQKQVIPSd-HRSTLAKYTYat-geQIQEAI 106
gi 156382238  24 PPNEPLTDVGAK-----RSKIDAAIKKVQs-eTVELPVLCGGEkvyTGNVKYQVSPFd-HSNKIAKYHVad-eaLVKETI 95
gi 145237872  42 ARNEPNLDYTRGsp--eRAEVEKVLKQMKsqlPLKSQSYVGGKalsVSNTLQQPLPAe-HATTFTNYPSvn-aaQVNAAI 117
gi 66810876   21 PVNQPMLNYEVGst--hRKLLKEACAKFRn-tTIDIPCVVGGKeirTGDVQKQLICSd-HNKVLATFHQan-aeLLKLAV 95
gi 167521247 157 VYNEPVWDYVKGvdddnRANIREACQVVRn-eTVDIPCVINGEeiySGNTVDQLAPSq-HELTIARIHHad-eaMIKRAI 233
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
gi 62511241  107 EAALAARKEWDlKPIADRAQIFLKAADMLSGPRRAEILAKTMVG-QGKTVIQAEIDAAAELIDFFRFNAKYAVELEGQQP 185
gi 67904582   86 PGALEARKVWAnMPFRDRAAIYKRAALLVETPKYRWKLMAAAMIgQGKTCGQAEGDCITEVIDTLNFHVYFCAQLYQQQP 165
gi 2494072    90 CGALQAKDGWEtMPWNDRAAIFLKAADLASGKYRYKLMAATMLG-QGKNTWQAEIDAAAELADFFRFGVSYVEELYAQQP 168
gi 146345498 110 ESALEARKSWAsTPFADRASVFLKAADLISTKYRYDVMALTMHG-QGKNAWQAEIDSAAELCDFFRFGVKYAEDLYAQQP 188
gi 115384268 115 EAALKAKPAWEaMPFEDRAAIFLRAAELVTGKYRADIVAATMLG-QGKNIWQAEIDAPAETADFFRCYVQECWSLYGQQP 193
gi 17534447  107 DVALQARGAWErKPLKERAEILLRAADLAAGKYRMKLNASTMLG-QGKNIIQAEIDAACELIDFFRFNAVFAMELEHYEP 185
gi 156382238  96 KRAVAARKAWDrTPFEERAKILLKVADMISGKYRFETIANTMVG-QGKTVFEADIDAIAELADFYRFAVHYAREMLQGPE 174
gi 145237872 118 DAALEAKEAWQnTPFVDRAAIFLKAAELVAGKYRYELIAATMLG-QGKNIWQGEIDAAAELADFFRLNCNYAAELLEKQP 196
gi 66810876   96 ENSMESKAQWEsLPFEARSAVFLKAADLLNTKYRYDVLASTMLG-QGKTVWQAEIDAAAEGIDFLRFNVKYAQEIYQQQP 174
gi 167521247 234 DGAVEARKEWElMPWEHRAAVFLRAADMLTTEYRFRALATTMIG-QGKNVYQAEIDAAAEAADFFRFGVHYANEILHQQP 312
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                              ##                        # ##                            
gi 62511241  186 Isvp-pstNSTVYRGLEGFVAAISPFNFTAIGGNLAGAPALMGNVVLWKPSDTAMLASYAVYRILREAGLPPNIIQFVPA 264
gi 67904582  166 PkqfasssSKLDYRPLEGFVLAVSPFNFTALGAHIALTPAILGNVVLWKPSPMAVLSNYILYQIMEEAGLPKGVVQFLPV 245
gi 2494072   169 PknapgcwNRTEYRPLEGFVLAVSPFNFTAIGGNLPGSPALVGNVVVWKPAPAATYSNYLVFKILSEAGVPPGVIQFIPG 248
gi 146345498 189 VhhapgvwNRVEYRPLEGFVYAISPFNFTAIGGNLAGAPALMGNVVVWKPSPSAIASNWLVHQILLEAGLPKNVIQFVPG 268
gi 115384268 194 RvqaegtwGKLEYRPLEGFVYAVAPFNFTALGATLVGPAALLGNVVIWKPSDSALHASWLLHRILLEAGLPKDVIQFLPG 273
gi 17534447  186 Istk-itkNTMQFRGMEGFVAAIAPFNFTAIGGNLPTAPALMGNVSLWKPSNTAVLSNYIIYELLEEAGMPPGILSFLPS 264
gi 156382238 175 LhqpkgvsNKLQYRGLEGFVAAVSPFNFTAIGGNLAGTPALMGNVVLWKPASTAILSQYRVMEMFQEAGLPDGVINFVPS 254
gi 145237872 197 DrgtegmwTRVDYRPLEGFVYAVSPFNFTAIGGNLISGPALMGNVVVWKPSDSNVYASELVYKILLEAGLPPNVIQFVTG 276
gi 66810876  175 PansagcwNILTYQPLEGYVVAISPFNFTAIGLNLSSAPALMGNVVLWKPASTAVLSNWIVYKALLEAGLPAGVIQFLPG 254
gi 167521247 313 EhhaahvwNRLTYRALEGFVAAVPPFNFTAIGANLGACPAIMGNSVLWKPTETAALSNFTIFQILREAGIPDGVIQFVPS 392
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                            #  #  #                                                     
gi 62511241  265 DGPl-FGDTVTSSEhLCGINFTGSVPTFKHLWKQVAQNLDr--FHTFPRLAGECGGKNFHFVHRSA--DVESVVSGTLRS 339
gi 67904582  246 ADPttVVDPALSSRdFAGLHYTGSSVVLRSLCARIGVNTHi--YRNLPRVVGESGGKNFHLVHNSCkdDVDWLASAAVRS 323
gi 2494072   249 GAE--IVQAAIQSPnFRSLHFTGSTNVFKSLWKDISSNLDk--YKVYPRIVGETGGKNWHVIHKSA--EVRNAVLQSVRG 322
gi 146345498 269 EAEe-VTKTVLDHPdFAALHFTGSTNVFRNLYGQISTRVAagkYRSYPRIVGETGGKNFHLIHKSA--DIRNAAVQTVRG 345
gi 115384268 274 DAEv-VTNTLLQRPeFAALSFIGSTQVFKGLQKKIGAGVGqgiYNSYPRVVGETGGKNWGLVHPSA--NIKNAVLNTIRA 350
gi 17534447  265 DGPv-FGDVITASPhLSAVNFTGSVPTFKTIWRKVAENLDn--YVTFPKLIGECGGKNFHFVHPSA--HVDAVAAGTARS 339
gi 156382238 255 SGSt-FGNAMTTSPhLAAVNFTGSVDTFKRIWRMVTDNLDt--YRTYPKLVGECGGKNYHFVHMSA--DLDVVVNSTIRA 329
gi 145237872 277 DAQe-ITQTVLGRReFGGLNFTGSSDVFRSLYAQVGENIGkkvYRDYPRLVGETSGKNFHLVHPTA--DIQSAVYHTLRG 353
gi 66810876  255 SGRl-VGEHLFNNRnFSGLHFTGSTGVFNDIYKKTADNLVagvYKGYPRIVGETGGKDFHFLHNSG--DVENFVNNTLRG 331
gi 167521247 393 YGPt-FGDTVAADPrLAAINFTGSTKTFDHLTQLVASRVSt--YNTYPRLIGECGGKNFHWLHESA--DVEDTVNGTIRS 467
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
gi 62511241  340 AFEYGGQKCSACSRLYVPhs--lWPQIKGRLLEEHSRIKVGDPAEdfgTFFSAVIDAKSFARIKKWLEHARss-psLTIL 416
gi 67904582  324 AYEFQGQKCSALSRFYVPrslwdQGDLKKALLREAAKMTHGDDVKdlhHPLGPLVSQEAFQRFQQFVDRAQsd--gHELV 401
gi 2494072   323 AFEYQGQKCSALSRLYVSrs-vwENGFKTQYLEEIAKIKVGPCLDw-nNYMGPVIGRRAYDNITGFIKKAKee--gGEVL 398
gi 146345498 346 AFEYQGQKCSATSRVYVAss--iADSFLEQVASEAKSLKVGPPSDf-tNFCGPVIHEASFTKLAKVIDEAKnd-peLELL 421
gi 115384268 351 AFEYQGQKCSANSRLYVAes--aWPEFKRLLQAQLSKLTVGPVDEy-nHFVNAVIHERAYDRLAEVLHAARsd-peLELV 426
gi 17534447  340 AWEYSGQKCSACSRMYAPks--iWPKILEKISAIHKEIKLGDVRDg-sVFLSAVIDDKAFARLKAYIDFAKtgadgANVV 416
gi 156382238 330 AFGYQGQKCSACSRLYVPks--rWPEIKEALLAELKTAKMGSPVDidnTFMTAVIDEASFDNIKTYLDFCKss-deITVL 406
gi 145237872 354 AFEYQGQKCSATSRLYLPes--rAQEFLEKLKSEIKEITIGSPEEm-gAFMGPVIHKASFEKIKSVIDASNkd-psLELI 429
gi 66810876  332 AFEYQGQKCSACSRAYIPqs--lWPQIKDRLVTGVKSMKMGQSDDf-sSFVSAVIDKNSFNNIQSYIEHAKas-pdAEII 407
gi 167521247 468 AFEYQGQKCSACSRVYVPrs--lWPEYKAGMIEALKELRVGQPDEf-sSFMTAVIDEKSFDKISGYIEHARqs-ddYEIL 543
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
gi 62511241  417 AGGKCDDSvGYFVEPCIVESKDPq--EPIMKEEIFGPVLSVYVYPDd---KYKETLQLVDSTTs-YGLTGAVFSqDKDVV 490
gi 67904582  402 YGGKTDGSrGFFVQPAIFMASDGdsdSELMTTELFGPLFAVQTYDDssptGFEKVCELIDKTSe-YGLAGSVFSrDRMAI 480
gi 2494072   399 IGGSGDDSkGFFIQPTVILTKVPr--STTMVGEIFGPVVTAYVFEDs---DYEKTLELIDTTSi-YGLTGAIFAsERQAL 472
gi 146345498 422 AGGSYDSSkGWYIQPTVYRTTNPd--HPLLTRELFGPILVVYAYPDateaDFARIAQKIDATGe-YGLTGSVFAqDREAL 498
gi 115384268 427 AGGHASKDeGYYVHPTVYRTTNPr--HDLMQRELFGPILTVYVYPDh---DWESTLDLVNTTSp-YALTGSIFAtDVAAT 500
gi 17534447  417 LGGKCDDKtGYFIEPTLITVTDPk--SKLLTEEMFGPVVTVLVYEDs---KVDEVLATVKDATp-YGLTGAVFSqDKEFL 490
gi 156382238 407 AGGNCDKSvGYFVEPTIVETSNPy--NKMMKEEIFGPVVCAYVYPDe---KYKEMMDVVDNTNe-FSLTGAIFGeDPTFI 480
gi 145237872 430 AGGTYDGStGYYVHPTVYRAKDPn--HELFDKEIFGPVLAVYVYPDa---EWSSVLKTVDQSGggFALTGAVFAgDRRAI 504
gi 66810876  408 VGGKCDSSvGWFVEPTIILAKDPh--YKSMEEEIFGPVLTIYVYEDs---KFEETLKICDETSp-YALTGSIFStCRYAI 481
gi 167521247 544 FGGECDKStGYFIQPTMIQTTDPk--SRLMQEEIFGPVVTAYVYEDe---DWESCLQTVNETSp-YGLTGAVYArDRSVI 617
                        490       500       510       520       530       540
                 ....*....|....*....|....*....|....*....|....*....|....*....|...
Feature 1                                                                       
gi 62511241  491 QEATKVLRNAAGNFYINDKSTGSIVGQQPFGGARASGTNDKPGGPHYILRWTSPQVIKETHKP 553
gi 67904582  481 RVADEKLRDSVGMFCINDKSTGAIIGAHPFGGARSSGTNDKANSVNVLLRFSSIRCVKDTYVT 543
gi 2494072   473 LTATNRSRNAAGNIYYNEKCTGAVVGQQPFGGARGSGTNDKAGSISIFYRFVSARSIKENFVG 535
gi 146345498 499 AVANDVLRNAAGNFYINCKSTGAVVGQQPFGGARASGTNDKAGSGNLLSRFVSLRSIKEEFVP 561
gi 115384268 501 RQAQTALKHAAGMLYINTKCTGAVVGQHPFGGSRDSGTNDKTGTMAHLQRFVSVQTIKEEFTE 563
gi 17534447  491 YRARDVLRDAVGNMYLNDKSTGSIVGQQPFGGSRLSGTNDKAGGPHYGLRWTSPLTIKETSVS 553
gi 156382238 481 EEARDALRESCGNFYVNDKCTGSVVAQQPFGGARMSGTNDKAGGPMYLGRWVSPLSVKEAYEP 543
gi 145237872 505 REAEDTLRYSAGNFYINCKTTAALIGQQSFGGSRSSGTNDKAGSANVLMRFASPRTIKEEFFP 567
gi 66810876  482 ETAHKYLKNAAGNFYINDKCTGAVVGQQPFGGSRASGTNDKAGSSLNLLRWISARTIKENFVP 544
gi 167521247 618 DTSLRVLHHAAGNIYINAKSTGSVVGQQPFGGARRSGTNDKAGAANYLLRFTSIQSAKECLYR 680

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap