Conserved Protein Domain Family
ALDH_PutA-P5CDH

?
cd07125: ALDH_PutA-P5CDH 
Delta(1)-pyrroline-5-carboxylate dehydrogenase, PutA
The proline catabolic enzymes of the aldehyde dehydrogenase (ALDH) protein superfamily, proline dehydrogenase and Delta(1)-pyrroline-5-carboxylate dehydrogenase (P5CDH, (EC=1.5.1.12 )), catalyze the two-step oxidation of proline to glutamate; P5CDH catalyzes the oxidation of glutamate semialdehyde, utilizing NAD+ as the electron acceptor. In some bacteria, the two enzymes are fused into the bifunctional flavoenzyme, proline utilization A (PutA) These enzymes play important roles in cellular redox control, superoxide generation, and apoptosis. In certain prokaryotes such as Escherichia coli, PutA is also a transcriptional repressor of the proline utilization genes.
Statistics
?
PSSM-Id: 143443
View PSSM: cd07125
Aligned: 33 rows
Threshold Bit Score: 631.153
Threshold Setting Gi: 25026657
Created: 14-Jan-2009
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
 
Feature 1:NAD binding site [chemical binding site]
Evidence:
  • Comment:based on similarity to structure 2BJA: 1-Pyrroline-5-Carboxylate Dehydrogenase with bound NAD from Thermus thermophilus.

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                         
gi 24375268   486 ANTSFVHKLVDPKTPieslvvhplktltsyktlannkiv-----------------------------lpidifgsdrkn 536
gi 187736545  440 SEENFLHDLFGMTPGsrswevqkkrflkacqekdevkygpnrtq------------------nraadpiqpshyrdafan 501
gi 46445667   439 APENFLRHAFDLRPGtddwnnqvhlfkqacqnyeqvsdqprrlq-------------------nrlhkdrllnqrkcfqn 499
gi 196232072  425 GPDNFLRHAFRLHVGteewnalergfreafhlgisdaprrtqnrtvphnetareeapwmelvnepdtdfalpqnsdwaeq 504
gi 198256581  422 SPQNFLTHSFNLEPGdedwtflanqfrfsfgridrlkseafrtqnrl------------nekssalqttfgndrfkdepd 489
gi 207085515  424 AEQNFLRHSFGLEVDtpewerlvgsykksiemlddieliphrtqdrn-------------seefinaigdevyefknepd 490
gi 68535524   425 AKQNFLYALFTPEDDetdvtgmtpmqgqelrfrnsvr--------------------------------drwetfagsrr 472
gi 32475276   450 GAENFLRHAYRLQPDspdfellagrfkdalmdcetvsvqprrtqnry------------qtpvqppaaehwtqfvnepdt 517
gi 15611119   416 SSDNFMKAFFNLKVGtsewkdqeqrflnslkgiatldntthrtqd----------------rnakqtghttypnhsfkne 479
gi 25026657   540 ASENFMSVIFDLEADnpafrreesrfrasiedlaglidapvp-----------------------gpndtqdrgaqeaet 596
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                         
gi 24375268   537 skglnmniiseAEPFFAALDKFKst--qWQAGPLVNGqpl-------------tgEHKTIVSPfd---ttQTVGQVAFAd 598
gi 187736545  502 erdtdwslrqnAEWINGLIAAEKek--sGEEIPLVIDgeei-----------ttnLWGVGRDPsr---hnEVSYKFAYAd 565
gi 46445667   500 vadtdwslshnRQWAKIIIDQWKnk--kHPDVPLVINgfhyts-------enrwgIGEDPSFPg------KILYRYALAs 564
gi 196232072  505 ivhaegprsveIQNRDGALTEQLppnesLPRIPLVLGgeti-----------rnrETRPCLDPsr---pgVTLCDYALAt 570
gi 198256581  490 tdwtlaanrewAGMIREKWKAKPdg--rVVEIPISVGeefl----------yenlDTAGIIDHsqh-ekqIPIARYALAr 556
gi 207085515  491 tdfalasnirwAEKIRDKWKNIGan--gGYHASSVIGgktl-----------ehgDAIEVIDKsqy-henVVLGSYKKAa 556
gi 68535524   473 tqnrlkeeaekKGCQSDGLPGNFvn--ePDTDPTLPAnr---------------eWALKIVDPssd-pgpAQTPEVTDP- 533
gi 32475276   518 dwslphnskwaQETLDRWKPLCDeq--aTRVTPVLVGlpdvdsldgddrvsaewfTTDDVSRPg------VVTCRYKNA- 588
gi 15611119   480 sdtdfilkanrEWAKKVRDKMHNap--iLELYPEIDGrfed-----------pnlTPLEVFDRih----hKKIASVHLAd 542
gi 25026657   597 leaagerarelEAARAPDQLPPFan--ePDTNPALTAnq--------------qwARAAIKRSagegwleQQTAPLSVEe 660
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                         
gi 24375268   599 kAAIEQAVSSAHAAFGSWTr-tPVEVRASALQKLADLLEENREELIALCTREAGKSIQDGIDEVREAVDFCRYYAVQAKK 677
gi 187736545  566 fDQVEHALVTADRVRSSWAs-kSIGERAEILHRAAQELSRIRGEAIAAMVRDAGKAPTEADVEVSEAIDFCRYYAEGLDR 644
gi 46445667   565 kEQVDEALDAAQNAYLKWSa-tTSQERANLLIKIAQGLELHRADLIGAMIADTAKTLIEADIEVSEAIDFANYYRFNLLE 643
gi 196232072  571 dDDVDRAVAAAHADVTGWRs-lSHQARSAILGTVAAELRKARGALMWAALANGGKTLTESDPEVSEAIDFLEFYRASARE 649
gi 198256581  557 iEDIDRAMEIAAGDESGWAe-mTLAQRHEVLSAAAQELRQARGDLIGVAAAEVGKLFGETDTEVSEAVDFAEFYPFAMQG 635
gi 207085515  557 iQDLEDAVEIAKDDPDGWRk-tSINYREKILMSVANEFKKDRADLIGIAAAEVGKVFSETDVEISEAIDFLNFYPYSVQK 635
gi 68535524   534 -AVIDAAVARCREASAQWSq-kTGAERAELLDQAAHALANNRSKLISAAVFEAGKTVAETDPEVSEAIDFARYYAESARQ 611
gi 32475276   589 -TSPAVESAVRASSESTWAadlSVDERYSVLRSVAQLARERRGDWIGSMVAGAGKTVAEADPEVSEAIDFLEFYPLTMKA 667
gi 15611119   543 kEAILKALEVAKSDKSRFSq-kSFTEIHALLSQTAQLFRERRGDLIGISALEVGKTFAETDAEVSEAIDFLEFYPYSLRV 621
gi 25026657   661 -EDIDALIEGTRAAAAEWAa-lPPMERARILYRTADILAARRGHLVSIAAAEVGKVVEQTDPEISEAIDFARYYAHRALE 738
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                     ##                         # ##                     
gi 24375268   678 lmskpellpgpTGELNELFLQGRGVFVCISPWNFPLAIFLGQVSAALAAGNTVVAKPAEQTSIIGYRAVQLAHQAGIPTD 757
gi 187736545  645 -----------DGMNDGVEMSPLGIICVMSPWNFPFAIPTGGVAAALMAGNAVVFKPSELAVYTAWQIVQAFWRAGVPKN 713
gi 46445667   644 -----------WMYLEDVKWSAKGVVVIAPPWNFPCSIAAGGILAALVTGNTVILKPAFESVLVCWHLAQIFWEAGISQQ 712
gi 196232072  650 -----------FFELPTLEARALGVVVVVPPWNFPIAIPCGGMAAALAAGNTVILKPASDTVLVAWELCQCFWRGGVPRE 718
gi 198256581  636 -----------FVERKNLEFRGKGVGVIIPPWNFPIAIPAGGVLASLAAGNNTILKPSPQAAYCGWLICQALWKTGVPRK 704
gi 207085515  636 -----------ISKLEGVKLSAKGVGLVVSPWNFPIAIAVGGIAAALASGNTVILKPASVSVLCAHRLCECFWRAGISKN 704
gi 68535524   612 -----------LDHVRGSVFTPYKSVVVTPPWNFPIAIPLGGVFAALAAGSCVIIKPAPQVLRIAEVFMEILREAGISED 680
gi 32475276   668 -----------WDECAGIQCEPRGVVAVITPWNFPLAIACGGIAAAIAAGNPVVVKPSMQTLLPAWLMCQAFWDAGVPRD 736
gi 15611119   622 l----------QEQNKKTKFTPKGVGVVIAPWNFPVGISVGTIAAPLAAGNRVIYKPSSLSSVTGYKLCECFWDAGVPRD 691
gi 25026657   739 -----------LEQVDNADFTPDRVAVITPPWNFPIAIPAGSTFAALAAGAGVIHKPSKPSQHCSAAVVEALWEAGVPRR 807
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                 #                 #  #  #                                               
gi 24375268   758 VLQYLPGTGAtVGNALTADErIGGVCFTGSTGTAKLINRTLAnregaIIPLIAETGGQNAMVVDSTSQPEQVVNDVVSSS 837
gi 187736545  714 VLQFVPMPRNeISCKFLMDPrLNGVIMTGSYRTGKMLRELRP-----DLHVLAETSGKDAMIITATADPDQAVKDLVKSA 788
gi 46445667   713 VLQFVVCEDEpVGSALIQDSrVNAVVLTGATETAKLFLRLRA-----DLDLMAETGGKNTMIITSMADRDLAIKDLVQSA 787
gi 196232072  719 VLQFVPCPGSgAGQRLVTHPhVDAVILTGGTATALHLLQARP-----DLRLFAETGGKNATIVTALADREQAIKHVLHSA 793
gi 198256581  705 ALQFLPCRNDpEASHLAAHPkTAFVIFTGSTRTALKMLQKRS-----QLPLYAETGGKNAMIISSMADRDKAIADVIQSA 779
gi 207085515  705 TLQLVITDGErAGEHLIPNPdIDFVIFTGGESTAYEMLKKCP-----SLHLSAETGGKNATIVTSLADRDQAVKNVIQSA 779
gi 68535524   681 LVQLVNADEAeAGKRLVSHPdVESVILTGASETAKLFRGWKP-----RMVINAETSGKNAIIVTPAADPDLAVADIFKSA 755
gi 32475276   737 ALQFVICDDEvAEEQLVKNPiVDTVILTGGTSTAKRMLDVRP-----DLHLLAETGGKNVTIVTAMADRDLAIKHVLHSA 811
gi 15611119   692 ALIYLPSKGSdISEHLLKDEsIKFAILTGGEDTAYKMLKANP-----TLALSAETGGKNATIVSKMADRDQAIKNVIHSA 766
gi 25026657   808 VLHCVYPANReAGRRLVSHPeVDRVILTGSSETAAMFASWRP-----DLQINAETSGKNAMVITPAADRDLAVADLVHSA 882
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                         
gi 24375268   838 FTSAGQRCSALRVLFLQEDI--ADRVIDVLQGAMDELvIGNPSSIKTDVGPVIDATAKANLDAHIDHIKqVGKLIKQMSL 915
gi 187736545  789 FGHSGQKCSAASVAIVEASVydNPAFLRQLKDAAASLkVGGSWEVNSVVTPLIREPEGNLLRALTQLEPgEEWLLKPEPS 868
gi 46445667   788 FSHAGQKCSACSLAIVEAETydNLHFRQQLKDSVESLsIGSPWKLKSKVNPLIREANPNLLRGLTQLEEgEEWLVQPKQD 867
gi 196232072  794 FSHSGQKCSATSLLLLEAEVydDPAFQRMLVDAVRSLhVGSAWDLETKIGPLIRPPAGELARALTALEPgESWAVEPLQV 873
gi 198256581  780 FGNSGQKCSATSLVLLQRSLfeDKSFRAALVDAAKSLpVGYAWEFKSKFGPLANPLGGPLKKVIDTIGEgEEWVLKPEVS 859
gi 207085515  780 FNNSGQKCSATSLLILEKELyvDKKFRAMLLDAAESLeVGSVWDFKNKIGTLSSKVSGNLAKSLEFLSEdEEWLLKPSYA 859
gi 68535524   756 YGHAGQKCSAASLIITVGSIgkSKRFINQLVDAVRSMkVGPGSDISTFMNGVIEEPGDKLLRGLTELDKgEKWLVKPRKL 835
gi 32475276   812 FGHSGQKCSATSLLLLENEVfdDPEFREILADAVRSLpVGSAWDLHTRVTPLVDPPTDKLRRGLQELEGgESWLVMSEHV 891
gi 15611119   767 FSNSGQKCSATSLLVLEKEVyeDENFKKTLIDATLSLsVGDPFDFKNKIGALADKPNEKVIKAIDELKSyENYEIPASFV 846
gi 25026657   883 FGHAGQKCSAASLGILVGTMytSERFRSQLVDAASSLvVDWPTNMSATVGPLTEQPSDKLQHALTQLEPgERWLLEPKPL 962
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                         
gi 24375268   916 PagtenGHFVAPTAVEID--SIKVLEKEHFGPILHVIRYKasELAHVIDEINSTGFGLTLGIHSRNEGHALEVADKVNVG 993
gi 187736545  869 Ed---nPCLWSPGIRLGVkpGSWFHQTECFGPVLGIIRAE--NLEEAIDIQNDSEFGLTGGLQSLDEREIALWKTKVQVG 943
gi 46445667   868 Pq---nPYLWSPGIKLGVkpGNFTYNTELFGPVLGLVRAE--NFDEALHMMNQTGYGLTAGIHTLDEREQKQWFQKIEAG 942
gi 196232072  874 Gd---nPHLWSPGVKWDVqpGSITHHTEFFGPLLGVIRFT--KLSEAISLVNATGYGLTSGLESLDEREQAEWRDGIRAG 948
gi 198256581  860 Es---dPHMVTPGILWNVtqSSFCYRKELFGPVIGVMRYD--TLEEAIRLVNETDYGLTSGIHSLDEREIAKWREEIRAG 934
gi 207085515  860 Den--nPYLLKPSIRWGThpGGFTHLNELFGPVLSVMSAD--DIYEAIEIVNETGYGLTSGIESLDEREQKIWREKIKAG 935
gi 68535524   836 Nd---eGTLWSPGLRDNVkpGSWFHTHECFGPVAGIMHAE--TLDEAIEWQNSTGFGLTGGIHTIDVDETAYWRERVEVG 910
gi 32475276   892 Dg---nPTLYRPGVKWDVqpGSFTHTTELFGPVMGVMRFG--RLEEAIEIVRSTGYGLTSGLESLDDREIKLWRESIPAG 966
gi 15611119   847 Dd---nPYLMKPSIKYGTkkGDFTHQTELFTPILSVMKAK--DLDEAIEIVNSTGYGLTSALESLDEREWEYYLERIEAG 921
gi 25026657   963 Dd---tGRLWRPGIKEGVqpGSFFHLTEVFGPVLGLMKAD--DLEQAIEYQNAVEFGLTGGIQSLDIDEVRTWVDAVEVG 1037
                         570       580       590       600       610       620
                  ....*....|....*....|....*....|....*....|....*....|....*....|.
Feature 1                                                                      
gi 24375268   994 NVYINRNQIGAVVGVQPFGGQGLSGT--GPKAGGPHYLTRFVTEKTRTNNITAIGGNATLL 1052
gi 187736545  944 NAYINRVITGAIVRRQPFGGWNHSSMgpGAKAGGPNYLTMLGSWEEKALPQKLRTPGERIS 1004
gi 46445667   943 NCYINRTMTGAIVERQPFGGCKESSFgkGSKAGGPNYLVQFMQTSQKNLPTEQKELKEMPL 1003
gi 196232072  949 NLYINRGTTGAIVLRQPFGGVGKSSFgpGMKAGGPNYVAQFQSFTERQTATNNRLVQQPRL 1009
gi 198256581  935 NLYINRGTTGAIVLRQPFGGMAKSAIgpGVKVGGWNYPLEFCDAVENGLPRDRRPNDPLLT 995
gi 207085515  936 NLYINRMTTGAIVTRQPFGGMGKSAIgsGKKAGGFNYVAQFMDIAHDITPLTQKSNHPYLQ 996
gi 68535524   911 NAYVERGITGAIVQRQSFGGWKNSALgsGAKAGGPNYVAQQGVWTEGDLSELAAGTLPTHI 971
gi 32475276   967 NLYINRPTTGAIVLRQPFGGVGLSAYgpGIKAGGPNYVLALSKVTHASDWTPPTDEVEASH 1027
gi 15611119   922 NIYINKPTTGAIVLRQPFGGVKKSAVgfGRKVGIFNYITQFVNIHQEEEDENALKNPLSEA 982
gi 25026657  1038 NVYVNRGITGAIVERQSFGGWKKSSVglGSKAGGPNYVMLMGRWSDKPAKDAPVKSSPLIN 1098

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap