Conserved Protein Domain Family
ALDH_AlkH-like

?
cd07134: ALDH_AlkH-like 
Pseudomonas putida Aldehyde dehydrogenase AlkH-like
Aldehyde dehydrogenase AlkH (locus name P12693, EC=1.2.1.3) of the alkBFGHJKL operon that allows Pseudomonas putida to metabolize alkanes and the aldehyde dehydrogenase AldX of Bacillus subtilis (locus P46329, EC=1.2.1.3), and similar sequences, are present in this CD.
Statistics
?
PSSM-Id: 143452
View PSSM: cd07134
Aligned: 23 rows
Threshold Bit Score: 676.637
Threshold Setting Gi: 21244955
Created: 1-Jan-2009
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
 
NAD(P) bindingcatalytic
Feature 1:NAD(P) binding site [chemical binding site]
Evidence:
  • Comment:based on similarity to structure 1AD3, class 3 rat liver aldehyde dehydrogenase (ALDH3A1)
  • Citation:PMID 9095201

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
gi 118500     20 LEVFNLQKVASSARrgkfGIAERIAALNLLKETIQRREPEIIAALAADFRKPasEVKLTEIFPVLQEINHAKRNLKDWMK 99
gi 1169283    10 QRVFQLQKKQQKALra-sTAEQRREKLQRFLDSVIAHEEEIIEAIRKDVRKPyhEVKKAEIEGTKKAIRDNMNNLEQWMA 88
gi 42523723    2 LERIFLHQKQFALKlrgeSLDVRIEALEALEKSIELHKQDIIDALKKDFQKPeaETLLSEIYPVLKEITYAKKNLSRWAK 81
gi 115376666  17 REAFERLQSRRWEMaq-tGAPERLARLARLKTNLLARREALAEAMFADFRKPraEVESTEVLPVLLELAHTARHLKAWMK 95
gi 108761809  20 RAVFEAQRAHRWTMsr-tTAAERIARLKRLREAIIARRAELADAIHADFRKPamEVDLTELHPTLEELNHTVRHLKSWMK 98
gi 83816545   18 ERVFAAQQAHAPAVra-aSVDRRRDKLRRLCDGLRAHRTDFQDAIHADFRKApaEVDLTEMKPLLDEAQFAISHLDDWMA 96
gi 159899043  72 HGQFAALQAQRGRIaa-sRAPERIGYLQQFKRAIEQARPDIHAALQADFAKPaaEIEATEIQQVIEQINFAIKRLETWMQ 150
gi 87199219   14 ARVFALQQAHMWEAka-sTAAERKEKLARLKAAVEAHADDIVAAVLEDTRKPvgEIRVTEVLNVTANIQRNIDNLDEWMK 92
gi 24213569   35 ERVFNLQKKHFHKVmkltTAGQRIQRLKKLKEAIFKYSPEIEKAVHSDFRKSerEVDITEIMPSISEINDAIKHVRRWMK 114
gi 163787680  18 QRIFNLHMQNKQEVrn-tTYADRRAKIKKLLKVYLKYRPQIREACYKDFKKHpiEVDLTEIYSVVHEAKHTLNHLHKWMK 96
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                     ###                         #                      
gi 118500    100 PRRVRaalsvaGTRAGLRYEPKGVCLIIAPWNYPFNLSFGPLVSALAAGNSVVIKPSElTPHTATLIGSIVReaFSVDLV 179
gi 1169283    89 PKEVGssl-spDANGILMYEPKGVTLILGPWNYPFMLTMAPLAASLAAGNSAIVKLSDfTMNTSNIAAKVIRdaFNEKEV 167
gi 42523723   82 GRRVPtpltlfGSKSYIVPEARGVCLLIAPWNYPFQLAFSPLVSAIASGNCAIMKPSEqTRHTSSIIKKITTeaFHPDHV 161
gi 115376666  96 PRRVGapvllaGTRSEVHSEPKGVVLVLSPWNYPFCLAINPLIAALAAGNCVMLKPSEkTPRTAAFLEALVRdtFEPSEV 175
gi 108761809  99 PMRVGtpmllaGSSSHVRYEARGTVLLLSPWNYPFNLLVSPLVAAIAAGNTVICKPSEkTPHTSRFLAQLVKdvFPENEV 178
gi 83816545   97 PDRRShpaffaGTRSEIHYEPKGVALILAPWNYPLTLTLGPLIGALAAGNCVTLKPSEkTPHTNIVLKKLIGdlYEEREV 176
gi 159899043 151 PKRVKtptmltGSKSWIQYEPRGVVLILAPWNYPLSLALMPLIGAVAAGNCAIVRPSErMPHTAQVVANIIAtaFKPEHV 230
gi 87199219   93 PVEVAtsl-npADRAQIIHEARGVCLILGPWNFPLGLALGPVAAAIAAGNTCIVKLTDlCPATARVASVIVReaFDEKDV 171
gi 24213569  115 PVDVKtpmtlfGSKSQIIYEPRGVVLIIGPWNYPFYLTFAPLAAAIAAGNTVLIKPSEfTPVTSNLIQKIISevFPKEEV 194
gi 163787680  97 PQKVStplalfGSSSKILYQSKGTVLIISPWNFPFTLTFEPLISAIAAGNTVIIKPSEiTSNSASLMKKIIEevFDEKEV 176
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1              #                 #                                                       
gi 118500    180 AVVEGDAAvSQELLALPFDHIFFTGSPRVGKLVMEAASKtLASVTLELGGKSPTIIGPTaNLPKAARNIVWGKFSNnGQT 259
gi 1169283   168 AIFEGEVEvATELLDQPFDHIFFTGSTNVGKIVMTAAAKhLASVTLELGGKSPTIIDSEyDLMDAAKKIAVGKFVNaGQT 247
gi 42523723  162 FVAEGGPEtTQELLSFAFDHIFFTGSTRVGKIVMTAAAKnLASVTLELGGKSPTIVDATaNLAEAAEKIAWAKFINaGQT 241
gi 115376666 176 TVVQGGPDvGDALLQLPFDHFFFTGGSRVGQKVMAAAARhLAGVTLELGGKSPVIVDATaDVKAAAERIIWGKFVNaGQT 255
gi 108761809 179 ALFEGGAEtAEALLELPFDHIFFTGNTRIGRKVMEAAAKhLASVTLELGGKSPVIVDETaDVAAAAERLCWGKFVNgGQT 258
gi 83816545  177 ALLTGAKEvAQGLLEQPYDHVYFTGSPRVGRLVMKDAADhLASVTLELGGKSPAIVDETaDLDLAAERIAWSKFTNaGQT 256
gi 159899043 231 TSVVGDVDtAEALLDLPFDHIFFTGSPRIGQYVMQRAAEhFSSVTLELGGKSPAIVDRSaDLKRAAQAIVWGKFVNaGQT 310
gi 87199219  172 ALFEGDVSvATALLDLPFNHVFFTGSPRVGKIVMAAAAKhLTSVTLELGGKSPVIVDDSaDIDQVAAQLAAAKQFNgGQA 251
gi 24213569  195 AVFEGDYQvSGALMELPLDHIFFTGSTHVGKIVMTAAAKhLTTVTLELGGKSPAIIDKSaDIKKAAKKLIWGKVLNaGQT 274
gi 163787680 177 AYFEGGVEtSTNLLKLPFNHIFFTGSPGVGKIVMAAAAKnLTSVTLELGGKSPTIIDETaNIDMAAKRTSWSKFLNnGQI 256
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                      # ##  #                           
gi 118500    260 CIAPDHVFVHrciAQKFNEILVKEIVRVygkdfaaqrrsADYCRIVNDQHFNRINKLLTDAKaKGAKILQGGQVdateRL 339
gi 1169283   248 CIAPDYLFIKkdvQDRFAGILQTVVNAGfmedd-htpdrSKFTQIVNDRNFNRVKDLFDDAIeRGAEVVFGGVFdasdRT 326
gi 42523723  242 CVAPDYLFVHesvQHNFKKHLIAALEKFygksaeqrkqsPDFARMISFNHSQRLKDLIDEAVsKNAKVFFGGESqpeeHY 321
gi 115376666 256 CIAPDHVYVHasrEEELLAGMKEALERFygkteearrasPDLCRMVDDAAFARVRGLLDRTVqAGARLVAGGGVdaasRY 335
gi 108761809 259 CVAPDYVFVHaskERAFLDALKASITRFyggteqerqasPDLTRLVDPVAWRRVKDLLKRSVaAGAKVEVGGETdepsRY 338
gi 83816545  257 CIAPDYVLVDapvHDALVARLIDTIEHFygataamrrgsDDYARLIDDGHWDRVVGLLEEAVaDGATVAFGGQTnaetRY 336
gi 159899043 311 CVAPDHVWVQreqAQALTQLIIKQIERNygkgdytrlqsPDLANVIDANATARLRGLVNNSVaQGALVALGGQStdhpAR 390
gi 87199219  252 CISPDYVFVKedkKAALVEGFRANVQKNlydda-gnlkkDSIAQVVNKANFDRVKAMFDDAVaKGATVAAGGTFeaddLT 330
gi 24213569  275 CVAPDYLLIPnelIKPFVEEAKTVIKEFygns---lkenSDFCRIVNDRNFNRVSGYIHEAVeKGAKIEMGGDTdasqNY 351
gi 163787680 257 CIAPDHIFVHeskKDEYIASVKKYIKKFfsdd---askeSSYGRIVNQMHHQRISKYLEDAIeKGGKIEAGGKLdktqNY 333
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                          # #                                                           
gi 118500    340 VVPTVLSNVtaaMDINHEEIFGPLLPIIEYDdIDSVIKRVNDGDKPLALYVFSEdkQFVNNIVArTSSGSVGVNLSVVHF 419
gi 1169283   327 ISPTVLKNVtpdMKIMQEEIFASILPMMNYEdIDEVIDYVNDRDKPLALYVFSKnqDLIDNVLQhTTSGNAAINDVVVHF 406
gi 42523723  322 CGPTLIEGVdphSLIMQEEIFGPILPVMTFKeISEVIHFINERPKPLALYCYTHsqMNMEKIEKeTSSGGLVYNDSVIHF 401
gi 115376666 336 IAPTLLADVtarSPVMEEEIFGPLLPVLRYErVETLVESLRADGKPLALYLFSQddAAVEYLLKrTSAGGTVVNNVLLQV 415
gi 108761809 339 IAPTVLSGVtaeNPVMEGEIFGPVLPVLTFQsREEVYAHIRAGGKPLALYVFSQdkRAVEDIFQnTTSGGAVVNNVLVHL 418
gi 83816545  337 VSPTILTDVpldTAVMQAEIFGPLLPIIPISsLNQAVGIVNDRPNPLSMYLFSErdAMVDTVLGrTTAGSTCINEGFFHY 416
gi 159899043 391 FAPTVLTNVkpsMAIMQEEIFGPILPILVYDqIDEVIMATRASGKPLTMAIFAEnqAIINWLLReIPAGSSMINGVLLNV 470
gi 87199219  331 IHPTMLTGVtpqMTILQDEIFAPVIPVMTYDtLDQAIGYIEARDKPLALYVYSKdeANVEKVLArTSSGGVTVNGVFSHY 410
gi 24213569  352 IEPTLLSNVpenSNIMEDEIFGPVLPMIPYTnLDEAIEKINSKPKPLALYIFGKkdRSIKKILKeTSSGGVAVNDVILHL 431
gi 163787680 334 ISPTIITNLsedSDLLQEEIFGPVMPIIAYKdIDEVIEKINSKETPLALYIYSKskKNINYVLNnTSAGGSCVNHNAIHY 413
                        410       420       430
                 ....*....|....*....|....*....|....*
Feature 1                                           
gi 118500    420 LHPNLPFGGVNNSGIGSAHGVYGFRAFSHEKPVLI 454
gi 1169283   407 SDVNLPFGGVNTSGIGSYHGVYGFKEFSHEKGVFI 441
gi 42523723  402 ANPHLPFGGVNHSGMGSYHGKHGFLEFSHQKAVLK 436
gi 115376666 416 ANPHLPFGGVGQSGLGAYHGEEGFRELSHARAVLW 450
gi 108761809 419 ANPNLPFGGVGTSGLGNYHGHFGFKTFSHERAVMV 453
gi 83816545  417 ANPDLPFGGAGHSGIGRGHGEAGFRAFSNERSVLR 451
gi 159899043 471 VNPNLPFGGVGQSGIGNYHGFYSFKTFSHERAVFQ 505
gi 87199219  411 LENNLPFGGVNTSGMGSYHGVFGFKCFSHERAVYR 445
gi 24213569  432 ANPNLPFGGINHSGHGSYHGYFGFKAFSHERSVLR 466
gi 163787680 414 FNNNLPFGGSNNSGIGKAKGIFGFQAFSNARGVYQ 448

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap