2O2Q,2O2R


Conserved Protein Domain Family
ALDH_F1L_FTFDH

?
cd07140: ALDH_F1L_FTFDH 
Click on image for an interactive view with Cn3D
10-formyltetrahydrofolate dehydrogenase, ALDH family 1L
10-formyltetrahydrofolate dehydrogenase (FTHFDH, EC=1.5.1.6), also known as aldehyde dehydrogenase family 1 member L1 (ALDH1L1) in humans, is a multi-domain homotetramer with an N-terminal formyl transferase domain and a C-terminal ALDH domain. FTHFDH catalyzes an NADP+-dependent dehydrogenase reaction resulting in the conversion of 10-formyltetrahydrofolate to tetrahydrofolate and CO2. The ALDH domain is also capable of the oxidation of short chain aldehydes to their corresponding acids.
Statistics
?
PSSM-Id: 143458
View PSSM: cd07140
Aligned: 10 rows
Threshold Bit Score: 968.117
Threshold Setting Gi: 133930964
Created: 2-Jan-2009
Updated: 17-Jan-2013
Structure
?
Program:
Drawing:
Aligned Rows:
 
Conserved site includes 25 residues -Click on image for an interactive view with Cn3D
Feature 1:NADP binding site [chemical binding site]
Evidence:
  • Structure:2O2Q: rat 10'formyltetrahydrofolate dehydrogenase in complex with NADP+, defined using 3.5 A.
    View structure with Cn3D
  • Structure:2O2R: rat 10'formyltetrahydrofolate dehydrogenase in complex with NADPH, defined using 3.5 A.
    View structure with Cn3D
  • Comment:FTHFDH binds the 2'-phosphate group of NADP via a water-mediated contact with Gln600 that may contribute to the specificity of the enzyme for NADP over NAD.
  • Comment:When reduced, the nicotinamide ring of NADP is displaced from the active site, restoring the contact between Cys707 and Glu673 and allowing the latter to activate the hydrolytic water molecule in deacylation.

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                         
2O2Q_A         32 TLQMPYQLFIGGEFVDAEGSKTYNTINPTDGSVICQVSLaqvsDVDKAVAAAKEAFENGlwgkINARDRGRLLYRLADVM 111
2O2R_A         32 TLQMPYQLFIGGEFVDAEGSKTYNTINPTDGSVICQVSLaqvsDVDKAVAAAKEAFENGlwgkINARDRGRLLYRLADVM 111
gi 47210430   517 TVKMPNQCFINGRFEDAESGKTYNTVNPSDGSVICNVSYasvgDVDRAVAAAKEAYDNGpwgkMNPRDRGSLLYRLADLM 596
gi 82201051   417 TVKIPHQLFINGQFMDAEGGKSYDTINPTDGTAICKVSLaqisDIDRAVAAAKEAFENGewgkMNPRDRGRLLYRLADLM 496
gi 118082834  438 TVNMPYQCFINGQFVNADDGKTYDTINPTDGSVIASVSSaslaDVDRAVAAAKEAFENGewgrMNARERGRLMYKLADLM 517
gi 198438465  436 VLQMPHQLFINNEFVDAANGDEYNTINPADESVICKVSKatveDVDEAVEAAKEAFEVGpwstMNPRDRGEMMFKLANLM 515
gi 196003002  436 DVKIPHQLFINNQFVDSISGKFFKTINPTDESVICKVSYateeDVNVAVQAAKEAFEGDwg-kMNARDRGKLMYRLADLM 514
gi 156398476  389 TIHMPHQLFINGEFVDSHHGKTFNTINPTDGTVLAQVSLatheDVDDAVDAAKEAFYNGpwgsMNARDRATLMNRLADLM 468
gi 24585660   428 EIRVPTQLFINGEFVDAEAQRTLEIVNPTNEEVLCKVACasatDVDKAVRAAHSAFYGSwr-qITPRQRGQLMLNLADLM 506
gi 133930964  423 ELKFPHDQFIDGKFVGSSDGRTFKTINPATEKPICELPLatvaDVDRAVRAAKKAFERGewrqMSARERGKRLYKLAELM 502
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                  ## ##  
2O2Q_A        112 EQHQEELATIEALDAGAVYTLALKTHVGMSIQTFRYFAGWCDKIQGATIPINqARPNRNLTLTKKEPVGVCGIVIPWNYP 191
2O2R_A        112 EQHQEELATIEALDAGAVYTLALKTHVGMSIQTFRYFAGWCDKIQGATIPINqARPNRNLTLTKKEPVGVCGIVIPWNYP 191
gi 47210430   597 EEHQEELATIETIDSGAVYTLALKTHVGMSIQTFRYFAGWCDKIQGKTIPINqARPNRNLTFTKKEPLGVCAIVIPWNYP 676
gi 82201051   497 EEHQEELATIESIDSGAVYTLALKTHVGMSIQTFRYFAGWCDKIQGRTIPINqARPNRNLTFTRREPIGVCGIVIPWNYP 576
gi 118082834  518 EEHQEELATIESIDSGAVYTLALKTHIGMSVQTFRYFAGWCDKIQGATIPINqARPNHNLTFTKKEPIGVCAIVIPWNYP 597
gi 198438465  516 EEHQEELAMIESIDSGAVYTLALKTHVGMSIQTFRYFAGWCDKIHGKTIPINqAHPNRNLTYTKREPIGVCAIVIPWNYP 595
gi 196003002  515 EEHLEELATIETLDSGAVYTLALKTHIGMSIDTFRYFAGYCDKIHGKTIPINnARPSHNLCLTRREPLGVCGIVIPWNYP 594
gi 156398476  469 EQHKEELATIESLDSGAVYTLALKTHVGMSIDTVRYFAGWCDKIQGLTVPVNnAKPNRNLCYTKREPIGVCGLIVPWNYP 548
gi 24585660   507 ERNKEELATIESVDSGAVYTLALKTHVGMSIEAWRYFAGWCDKIQGNTIPVNpARPNNVLTFTRKEPIGVCGLITPWNYP 586
gi 133930964  503 EEHKEELATLESLDAGAVYTLALKTHVGMSIDVWRYFAGWCDKIQGKTIPISnARPNKNLCLTLREPIGVVGLITPWNYP 582
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                             #  #                            ##   ##            ####  #  
2O2Q_A        192 LMMLSWKTAACLAAGNTVVIKPAQVtPLTALKFAELTLKAGIPKGVVNILPGSGslvGQRLSDHPDVRKIGFTGSTEVGK 271
2O2R_A        192 LMMLSWKTAACLAAGNTVVIKPAQVtPLTALKFAELTLKAGIPKGVVNILPGSGslvGQRLSDHPDVRKIGFTGSTEVGK 271
gi 47210430   677 LMMLAWKSAACLAAGNTLVLKPAQVtPLTALKFAELSVKAGIPKGVINILPGSGgmvGQRLSEHPDVRKLGFTGSTPIGK 756
gi 82201051   577 LMMLAWKTAACLTAGNTVVLKPAQVtPLTALKFAELSVKAGIPKGVINILPGAGsliGQRLSDHPDVRKIGFTGSTPIGK 656
gi 118082834  598 LMMLAWKSAACLAAGNTLVLKTAQVtPLTALKFAELSAKAGFPKGVINILPGSGglvGQHLSKHPDVRKVGFTGSTPTGK 677
gi 198438465  596 LMMLAWKMASCLAAGNTMVLKPAQVtPLTALKFAELVVKAGFPKGVINILPGAGsniGQRLADHPDIRKLGFTGSTPIGK 675
gi 196003002  595 LMMLAWKMSSCLAAGNTCVLKPAEVtPLSALKFAELTVKAGFPKGVINILPGSGrvcGQAICDHPDIRKVGFTGSTPIGR 674
gi 156398476  549 LMMLAWKISPLLAAGNTVVLKPAQVtPMTALKFAELAARAGFPKGVINILPGSGsvvGNRICEHPDVRKLGFTGSTPVGK 628
gi 24585660   587 LMMLSWKMAACIAAGNTCLIKPAQTcPLTALKFAELTVRAGFPPGVINVLPGKGsdaGQAVADHELVRKLGFTGSTPIGK 666
gi 133930964  583 LMMLSWKMAACLAAGNTVVHKPAQVtPLTALKFAELSVLAGIPPGVINIVTGSGslvGNRLTAHPDVRKIGFTGSTEIGA 662
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1         ##              ###                               #                             
2O2Q_A        272 HIMKSCAlsNVKKVSLELGGKSPLIIFADCDLNKAVQMGMSSVFFNKGENCIAAGRLFVEeSIHNQFVQKVVEEVEKMKI 351
2O2R_A        272 HIMKSCAlsNVKKVSLELGGKSPLIIFADCDLNKAVQMGMSSVFFNKGENCIAAGRLFVEeSIHNQFVQKVVEEVEKMKI 351
gi 47210430   757 QIMKSCAvsNLKKVSLELGGKSPLIIFRDCDMDKAVRMGMSSVYFNKGENCIAAGRLFVEeSIHDEFISRVVEEIKKMKI 836
gi 82201051   657 QIMKSCAvsNVKKVSLELGGKSPLIIFHDCDLDKAVRMGMSSVFFNKGENCIAAGRLFLEeSIHDEFVKRVVEEVKKMKI 736
gi 118082834  678 EIMKSAAt-NLKKVSLELGGKSPLIIFNDCELDKAVKMGMGAVYFNKGENCIAAGRLFVEeSIHDEFVRKVVEEIKKMKI 756
gi 198438465  676 QIMKSAAvsNLKKVSLELGGKSPLIIFSDCDMDKAVRFGMSSVFFNKGENCIAAGRLFVEdSIHDEFVARIIEEIKKMKI 755
gi 196003002  675 TVMKSAAesNLKKVSLELGGKSPLIIFQDCDMDKAVRQGMLSSLFNKGENCIAAGRIFVEeSIHDEYVARLVEEVKKLKI 754
gi 156398476  629 AIMESCAtsNLKKCSLELGGKSPLIIFSDCDMERAVRQGMMACLFNKGENCIAAGRLFVEeSIHDEFVNRLVDELKKLKI 708
gi 24585660   667 HIMKSCAdsNLKKCSLELGGKSPLIIFADCDMDKAVKHGMSSVFFNKGENCIAAGRLFVEdRIHDEFIRRVLKDLRTMTI 746
gi 133930964  663 TVMESCAksNIKKVSLELGGKSPLIIFADADLEKAVKQACGAVFFNKGENCIAAGRVFIAkSIHDDFVKKLVEEAKQYQI 742
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                             # #         
2O2Q_A        352 GNPLERDTNHGPQNHEAHLRKLVEYCQRGVKEGATLVCGGNQvp-rpGFFFQPTVFTDVeDHMYIAKEESFGPIMIISRF 430
2O2R_A        352 GNPLERDTNHGPQNHEAHLRKLVEYCQRGVKEGATLVCGGNQvp-rpGFFFQPTVFTDVeDHMYIAKEESFGPIMIISRF 430
gi 47210430   837 GDPLDRSTDHGPQNHKAHLDKLLEYCEVGVKEGATLVYGGRQvd-rpGFFMEPTVFTDVeDHMFIAKEESFGPVMVVSKF 915
gi 82201051   737 GDPLDRSTDHGPQNHKAHLDKLIEYCQTGVKEGGKLVYGGKQve-rpGFFFEPTIFTDVtDEMFIAKEESFGPVMIISKF 815
gi 118082834  757 GDPLDRSTDHGPQNHKAHLEKLLKYCETGVKEGATLVYGGRQvr-rpGYFMEPTVFTDVeDHMYIAQEESFGPVMVISKF 835
gi 198438465  756 GDPLSASTDHGPQNHKAHLDKLVEYCDVAVKEGATLTYGGKQcd-mpGLYMMPTVITDVqDHMYVAKEESFGPIMVVSKF 834
gi 196003002  755 GDPFDRSTAHGPQNHEKHMVKLLEYVDQAVAEGATLVYGGKRld-rsGFFMEPAVLTNVaDDNYAAIEESFGPVLVISSF 833
gi 156398476  709 GDPLDTATDHGPQNHKAHLDSLVEYVKRGVEEGAKLVYGGRHld-rpGFFFEPAVFTNVeDDMFIAKEESFGPVVIISKF 787
gi 24585660   747 GDPLDRSTAHGPQNHKAHFDKLLEFCRRGVDEGAKLVYGGCRvpnlkGYFFTPTVFTNVtDDMFIAQEESFGPIMIISKF 826
gi 133930964  743 GDPLDRSTAHGPQNHLAHLNKLVEYVEKAVAGGAKVEVGGKRle-reGLYFPPTILSNIdDENFAASEESFGPIMCVSSF 821
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                           #                                     #                       
2O2Q_A        431 ADGDVDAVLSRANATEFGLASGVFTRDINKALYVSDKLQAGTVFINTYNKTDVAAPFGGFKQSGFGKDLGEAALNEYLRI 510
2O2R_A        431 ADGDVDAVLSRANATEFGLASGVFTRDINKALYVSDKLQAGTVFINTYNKTDVAAPFGGFKQSGFGKDLGEAALNEYLRI 510
gi 47210430   916 QDGDVEGVLQRANDTEYGLASGVFTRDINKAMYVSERLEAGTVFVNTYNKTDVASPFGGFKQSGFGKDLGEDALMEYLKT 995
gi 82201051   816 NDGDIDGVLKRANDSEFGLASGVFTKDINKALYVSEKLQAGTVFVNTYNKTDVAAPFGGFKQSGFGKDLGEEALNEYLKT 895
gi 118082834  836 KNGDIDGVLQRANTTEYGLASGVFTKDISKALYISEKLEAGTVFINTYNKTDVAAPFGGFKQSGFGKDLGEEALHEYLRT 915
gi 198438465  835 PDGDVDGVLKRANDTEYGLASGVFTKDISKALYVSDKLDAGTVFVNTYNKTDVASPFGGFKQSGFGKDLGEDALNEYLKT 914
gi 196003002  834 KDGDVDGVLKRANKTEYGLASGVFTKDINKALLCSEKLDAGTVFVNTYNKTDVASPFGGFKQSGFGKDLGEEALNEYLKT 913
gi 156398476  788 DDGDVEGVLESANGTEYGLASGVFTKDMSKALRVADALEAGTCFVNTYNKTDVAAPFGGCKQSGFGKDLGMEALNEYLKT 867
gi 24585660   827 NGSDIDSLMQRANRTEYGLASGVFTKDIGKALNFADRIEAGTVFVNVYNKTDVAAPFGGFKQSGYGKDLGQEALNEYLKT 906
gi 133930964  822 DDDDIEDVLRRANDTEFGLAAGVFTRDSSKSLRVAEALHAGTVFVNTYQKTDVAAPFGGFKQSGFGKDMGEEALNEYLVT 901

                  ....*..
Feature 1                
2O2Q_A        511 KTVTFEY 517
2O2R_A        511 KTVTFEY 517
gi 47210430   996 KAVTVEY 1002
gi 82201051   896 KAVTIEY 902
gi 118082834  916 KAVTVEY 922
gi 198438465  915 KAVTLEY 921
gi 196003002  914 KTVTIEY 920
gi 156398476  868 KVITIEY 874
gi 24585660   907 KCVTVEY 913
gi 133930964  902 KTITIEY 908

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap