1LO1


Conserved Protein Domain Family
NR_DBD_ERR

?
cd07170: NR_DBD_ERR 
Click on image for an interactive view with Cn3D
DNA-binding domain of estrogen related receptors (ERR) is composed of two C4-type zinc fingers
DNA-binding domain of estrogen related receptors (ERRs) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which coordinates a single zinc atom. ERR interacts with the palindromic inverted repeat, 5'GGTCAnnnTGACC-3', upstream of the target gene and modulates the rate of transcriptional initiation. The estrogen receptor-related receptors (ERRs) are transcriptional regulators, which are closely related to the estrogen receptor (ER) family. Although ERRs lack the ability to bind to estrogen and are so-called orphan receptors, they share target genes, co-regulators and promoters with the estrogen receptor (ER) family. By targeting the same set of genes, ERRs seem to interfere with the classic ER-mediated estrogen response in various ways. Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, ERR has a central well conserved DNA binding domain (DBD), a variable N-terminal domain, a non-conserved hinge and a C-terminal ligand binding domain (LBD).
Statistics
?
PSSM-Id: 143544
View PSSM: cd07170
Aligned: 8 rows
Threshold Bit Score: 173.892
Threshold Setting Gi: 30749423
Created: 2-Feb-2009
Updated: 17-Jan-2013
Structure
?
Program:
Drawing:
Aligned Rows:
 
zinc bindingDNA binding
Conserved site includes 8 residues -Click on image for an interactive view with Cn3D
Feature 1:zinc binding site [ion binding site]
Evidence:
  • Structure:1LO1_A, Zinc binding site of Estrogen Related Receptor 2 Dna Binding Domain, defined by 3.5A contacts
    View structure with Cn3D
  • Comment:Zn finger, C4-type: The domain contains two groups of four Cys residues. Each group is involved in the coordination of a single zinc atom

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1              #  #             #  #               #     #         #  #                  
1LO1_A         1 XIPKRLCLVCGDIASGYHYGVASCEACKAFFKRTIQGNIEYSCPATNECEITKRRRKSCQACRFMKALKVGMLKEGVRLD 80
gi 55741600   99 SMPKRLCLVCGDIASGYHYGVASCEACKAFFKRTIQGNIEYSCPATNECEITKRRRKSCQACRFMKCLKVGMLKEGVRLD 178
gi 28574950  121 DELRRLCLVCGDVASGFHYGVASCEACKAFFKRTIQGNIEYTCPANNECEINKRRRKACQACRFQKCLLMGMLKEGVRLD 200
gi 118343759 170 TPPKRLCLVCGDIASGYHYGVASCEACKAFFKRTIQGSIDYTCPAANDCEITKRRRKSCQSCRFSKCLRVGMLREGVRLD 249
gi 115394376  83 DELKRLCLVCGDVASGYHYGVSSCEACKAFFKRTIQGNIEYSCPASGECEITKRRRKACQACRFQKCLRVGMLREGVRLD 162
gi 45479148    4 SIPKRLCLVCGDIASGYHYGVASCEACKAFFKRTIQGNIEYSCPATNECEITKRRRKSCQACRFMKCLKVGMLKEGVRLD 83
gi 147906332  64 SIPKRLCLVCGDVASGYHYGVASCEACKAFFKRTIQGNIEYSCPASNECEITKRRRKACQACRFTKCLRVGMLKEGVRLD 143
gi 44151597   46 TIHKPLYIMCQDIASGYHYRVASYKACKTFFKRTIQGNIKYSCPATNKCEITKQRRKFCQVCQFRKCLKVGMLKKSVHAD 125
                         90
                 ....*....|....*..
Feature 1                         
1LO1_A        81 RVRGGRQKYKRRLDSEN 97
gi 55741600  179 RVRGGRQKYKRRIDAEN 195
gi 28574950  201 RVRGGRQKYRRNPVSNS 217
gi 118343759 250 RVRGGRQKYKRKIDANE 266
gi 115394376 163 RVRGGRQKYKRSIDNQS 179
gi 45479148   84 RVRGGRQKYKRRMDAEN 100
gi 147906332 144 RVRGGRQKYKRRPDGDI 160
gi 44151597  126 QVLGGGQKYKGQLDLEK 142

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap