1HCQ


Conserved Protein Domain Family
NR_DBD_ER

?
cd07171: NR_DBD_ER 
Click on image for an interactive view with Cn3D
DNA-binding domain of estrogen receptors (ER) is composed of two C4-type zinc fingers
DNA-binding domain of estrogen receptors (ER) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which coordinates a single zinc atom. ER interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation. Estrogen receptor is a transcription regulator that mediates the biological effects of hormone estrogen. The binding of estrogen to the receptor triggers the dimerization and the binding of the receptor dimer to estrogen response element, which is a palindromic inverted repeat: 5'GGTCAnnnTGACC-3', of target genes. Through ER, estrogen regulates development, reproduction and homeostasis. Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, ER has a central well-conserved DNA binding domain (DBD), a variable N-terminal domain, a non-conserved hinge and a C-terminal ligand binding domain (LBD).
Statistics
?
PSSM-Id: 143545
View PSSM: cd07171
Aligned: 7 rows
Threshold Bit Score: 145.025
Threshold Setting Gi: 1311082
Created: 2-Feb-2009
Updated: 17-Jan-2013
Structure
?
Program:
Drawing:
Aligned Rows:
 
Conserved site includes 8 residues -Click on image for an interactive view with Cn3D
Feature 1:zinc binding site [ion binding site]
Evidence:
  • Structure:1HCQ_A; Zn binding site of human Estrogen Receptor Dna-Binding Domain, contacts determined at 4A
    View structure with Cn3D
  • Comment:Zn finger, C4-type: The domain contains two groups of four Cys residues. Each group is involved in the coordination of a single zinc atom.

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1             #  #             #  #                #     #         #  #                  
1HCQ_A         2 KETRYCAVCNDYASGYHYGVWSCEGCKAFFKRSIQG-HNDYMCPATNQCTIDKNRRKSCQACRLRKCYEVGMMKGGIRKD 80
gi 6015120   175 KETRYCAVCSDYASGYHYGVWSCEGCKAFFKRSIQG-HNDYMCPATNQCTIDKNRRKSCQACRLRKCYEVGMMKGGIRKD 253
gi 13124193  177 ADMHFCAVCHDYASGYHYGVWSCEGCKAFFKRSIQG-HNDYICPATNQCTIDKNRRKSCQACRLRKCYEVGMMKCGVRRE 255
gi 13124188  100 RDAHFCAVCSDYASGYHYGVWSCEGCKAFFKRSIQG-HNDYICPATNQCTIDKNRRKSCQACRLRKCYEVGMMKCGSRRE 178
gi 124001517 128 GPNKLCQVCSDNASGFHYGVWSCEGCKAFFKRSIQG-PVDYVCPATNTCTIDKHRRKSCQACRLRKCYEVGMNKGSQRKE 206
gi 193201685 292 KARAVCRVCGDHASGFHYGVWSCEGCKAFFKRSIQQgQTDYICPGTNQCTIDRNRRKSCQACRYRKCLMVGMTKDGRRSG 371
gi 186908731  47 KDVQKCQICSDLASGFHYGVWSCEGCKAFFKRSLQD-PVDYVCPATNNCTIDKHRRKSCQACRFRKCLEVGMMKRRERRT 125

                 ...
Feature 1           
1HCQ_A        81 RRG 83
gi 6015120   254 RRG 256
gi 13124193  256 RCS 258
gi 13124188  179 RCG 181
gi 124001517 207 RKG 209
gi 193201685 372 ERR 374
gi 186908731 126 TKK 128

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap