2Q7X,2HZB,2PPV


Conserved Protein Domain Family
YvcK_like

?
cd07187: YvcK_like 
Click on image for an interactive view with Cn3D
family of mostly uncharacterized proteins similar to B.subtilis YvcK
One member of this protein family, YvcK from Bacillus subtilis, has been proposed to play a role in carbon metabolism, since its function is essential for growth on intermediates of the Krebs cycle and the pentose phosphate pathway. In general, this family of mostly uncharacterized proteins is related to the CofD-like protein family. CofD has been characterized as a 2-phospho-L-lactate transferase involved in F420 biosynthesis. This family appears to have the same conserved phosphate binding site as the other family in this hierarchy, but a different substrate binding site.
Statistics
?
PSSM-Id: 132873
View PSSM: cd07187
Aligned: 56 rows
Threshold Bit Score: 202.026
Threshold Setting Gi: 16944482
Created: 26-Jan-2009
Updated: 17-Jan-2013
Structure
?
Program:
Drawing:
Aligned Rows:
 
Conserved site includes 5 residues -Click on image for an interactive view with Cn3D
Feature 1:putative substrate binding pocket [chemical binding site]
Evidence:
  • Comment:based on homology to other members of the family

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                           #   #              #  #                      
2Q7X_B         7 ITVIGGGTGSPVILXSLRExd----vEIAAIVTVADDGGSSGELRxnxqqltpPGDLRNVLVAXSdxpxfyexvf----- 77
gi 218152235   8 IVFFSGGTALNGLAAELAKvn----pKCAYIITTFDSGGSSAALRevfd-mpaVGDVRNRLLALAdkenpdkanivella 82
gi 171060719   4 IVMFGGGSGSRDITMALCRqr----yEVTRVVPAWDSGGSSRALRaalg-ilaMGDIRQALMTMAhgegrvssvvrffna 78
gi 168004169   1 MCVNAGGTAFNGVVEELKKwt----tRVSHVLPVSDDGGSTAEIVrvvg-gpaVGDIRSRCLRLSsdssvealavkrllg 75
gi 148908973  60 MLVFSGGTAFNGVVEELKKvt----tRVAHVLPVSDDGGSTAEIVrvlg-gpaVGDIRSRCLRLSdestsealavrrllg 134
gi 75097659   54 LLVFSGGTGFNGVVEELKKlt----tRVAHVLPVSDDGGSTAEIVrvlg-gpaVGDIRSRCLRLSdestsealavrrllg 128
gi 16944482    8 ITVFSGGTAANSLVDVFNGiiekkncQLNYIIPISDNGGSSSELIrfig-gpsVGDIRSRLVRLIpnpsnnqekaalkal 86
gi 202953513   8 IAVLSGGTATNELVSLFKSvs----aNITYILPISDNGGSTSELIritg-gpaIGDIRSRLTRLIpenqeplrkllsfrl 82
gi 151944519   3 VVVCSGGTATNSLTPCFSNisilkghELTYILPISDNGGSTSEILrivg-gpaIGDIRSRIVRLLqdeqlvelfghrlpn 81
gi 211589176   7 IVVVSGGSAANNLVDVFSAvreskncPLSYIIPISDNGGSSSELIrifg-gpgIGDVRSRLVRLIpdspehpersaikal 85
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                             #          
2Q7X_B        78 ----------------------------------------------------qyrfsedagaFAGHPLGNLIIAGLSEXQ 105
gi 218152235  83 trlpryadktalygqlshla--------ngshslmdgfseivrkilsdrfalfielagdnfdPVNASLGNIVLAAGFMAH 154
gi 171060719  79 rlsetssqpdllaefdfyv---------sgahpllatmepgirgailnylrvfqsniagdfdFCRGSIGNFVLTGAYFAH 149
gi 168004169  76 hrlsseeteakaewyeivege------hqlwdnvsgpyretiraflvhfqcqillrsvdkfsFRNGSIGNFFFAGARIFF 149
gi 148908973 135 hrlsldplqakaewyeiiege------hvlwngvsrpyretiraflvyfqnqilrrasenfcFGNGSIGNFFFAGARIFF 208
gi 75097659  129 hrlpidahqakkdwydivegnh---slwdgvsrpysetirafliyfqnevmltdtekhvfigFIFDHIGNFFFAGARIFF 205
gi 16944482   87 feyrlpgdpskariewldivear--hllwayisspkrelirsilntlnleivkrtrptstfnFAEASIGNMFLTGARIFS 164
gi 202953513  83 ssdpreakvqwndivdgthplwanidpstreifraffihvhgdllkrskhsfslhtnkrqfrYELANVGNLFLTGGRLFI 162
gi 151944519  82 dkllakkewneivegshpi---------wknisievkemcrsfiihmqaellkkikhsnpfqFESASIGNFFLTGARLFL 152
gi 211589176  86 fnhrlpaeagiatnewqsivdgt-sglwtaitpakkelirsffnvlnleilkrarppsstfdFTSASVGNLFLTAARLFS 164
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
2Q7X_B       106 gst-ynaXQLLSXFFht--tGXIYPSsd--hPLTLHAVFqDGTEVAGESHIvdh-------------------------- 154
gi 218152235 155 qrilappIAQLSRLIga--rGIVRAStv--dNGHLAVRLeNGEILAGQHQFtgketd----------------------- 207
gi 171060719 150 grdintaIFVFRKLCai--dGHVWPSta-ddTVELRAVLrDGQVVRGQERItdlnae----------------------- 203
gi 168004169 150 qsldaaiFLYSRVSHip-thSLVLPAistndRLTLGCELlDGTVIKGQNAIshpttalrvvc------------------ 210
gi 148908973 209 qsldaavFLFSRVSHip-tdSLVLPVicsndRLTLGCELwNGTVIRGQNEIshptsgavepin----------------- 270
gi 75097659  206 qsldaaiFLFSRVSEip-cdSLVLPVistndRLTLGCELqDGTIIRGQNEIshpttgttqtvd----------------- 267
gi 16944482  165 gsfesaiYLLSMICSip-pnVSVLPAinsnfTHHISAGLeDGTTIAGQVAIshpsaptalpddvkislatpsfppllhgg 243
gi 202953513 163 gsldsaiELFSRLTGid-adTQVLPClntnfTYHITALLeNGLIITGQSQIshpsesdtkvdihpppihashpgtpqegi 241
gi 151944519 153 gsldasiELMMRIGRcs-plVHVIPCintnhTHHISALLtNGEMITGQSQIshpsksvpkdnsiahsakfihllgsyddh 231
gi 211589176 165 gsfesaiYLLGSICGvpsdlVRVIPAinsnfSHHISASLaDGTVIVGQNSIshpseatafdhnsrsrrpsllladgddad 244
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
2Q7X_B           --------------------------------------------------------------------------------
gi 218152235     --------------------------------------------------------------------------------
gi 171060719     --------------------------------------------------------------------------------
gi 168004169     --------------------------------------------------------------------------------
gi 148908973     --------------------------------------------------------------------------------
gi 75097659      --------------------------------------------------------------------------------
gi 16944482  244 hghgappssanlhpaamvamamhdggiiklppqhltvpstagsssstaassssvttsqkttptkptfpslpsrpgarars 323
gi 202953513 242 ndnsesvfflrtndpahvny------------------------------------------------ndtnslvsdisd 273
gi 151944519 232 lkilldde------------------------------------------------------------------------ 239
gi 211589176 245 ytdsems------------------------------------------------------------------------- 251
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
2Q7X_B       155 ----------------------------------rgiIDNVYVTnalnd-----dtplASRRVVQTILESDxIVLGPGSL 195
gi 218152235 208 --------------------------------pisspIDGMWICsgvddp--wprpvhGSSLAINLVNNADmIVYPMGSF 253
gi 171060719 204 --------------------------------qaqagIERVELLhagdgrp-aasrpaANPAVLEAIGTADlMLFGPGSF 250
gi 168004169 211 --------------------------rsqtssplpspIKRIFYMssegnnifhevfpaVNPAVVEQLSLVDaIVYGMGSL 264
gi 148908973 271 -------------------------kvvssipalparIKRIFYMssegtnllhevfpaVNDTVLEQLNQVDcIVYAMGSL 325
gi 75097659  268 -------------------------krhcstsalpskIKRVFYMssegnnllhevfppVNPTVLEQLRSVDcIVYAMGSL 322
gi 16944482  324 rtetedaslpgslpslrtqnisfsksdsdeadqlsarIERVWYInpygh----eiwpnANPKVIDALAGTTmVVYSIGSL 399
gi 202953513 274 dssdeesghvpqythpalkksqlhfnksdhiepllspIERIYYIspyge----eicptANSRVTNSLANADvIVYSIGSL 349
gi 151944519 240 eeeaeeeyanpiyilpelknsqlhfdkldesqnlpapVHRILYInpyge----eikpmGNPRAISKVKKADmVVYSIGSL 315
gi 211589176 252 --dpttyeedhlpgslatlrnknikfsktenedlssrITRIWYInpygq----eirppANPRVLEAINDSQaIIYSIGSL 325
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
2Q7X_B       196 FTSILPNIVIXEIGRALLEtx-----------------------------aEIAYVCNixTQRGETEh---fTDSDHVEV 243
gi 218152235 254 YSSMLAAISPQGLGNAISLnp-----------------------------cPKVFIPNmgFDPELIGh----SINLQVER 300
gi 171060719 251 YTSTLPHLSVAGIAEAIRAapp---------------------------qvPKVFVGNilECPETIGg----TVAEQVRA 299
gi 168004169 265 YTSICPSLVLRGVGETIAArs-----------------------------cLKVMILNstYDRETFGm----PASAFVAS 311
gi 148908973 326 YTSVCPSLVLNGVGEAISIts-----------------------------cLKVLLLNgsHDRETTNm----TASDFVTA 372
gi 75097659  323 FTSICPSLVSTRNKYVVQKww----------------------------itKFVLLLNgsQDRETSRf----TASCFVTA 370
gi 16944482  400 WTSIVPSLVLRGVGEALAGeeeeeeeeeedqseegeqgqgqggmkttttttKKVLVLNatIDRETGPkskpmTATDFVRA 479
gi 202953513 350 MTSIVPIVILKGVGKAIANdiiqek---------------------ggrkkKRILLLNgvNDRETFGm----TAADFVRV 404
gi 151944519 316 MTSLLPILILGNLAEVILEsn----------------------------ntKKVLLINnkYDREVFGl----DGLHYVQM 363
gi 211589176 326 YTSIIPAIILRGVGKSIVSsp----------------------------arHKILILNgsLDRETGPpsapfSASDFVEA 377
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
2Q7X_B       244 LHRHlg-----------------------------------rpFIDTVLVNiexvpqeyxnsnr-------------fde 275
gi 218152235 301 LLEVlrmdnsa--------------------------yigseaVLNYILIDsengty----------------------- 331
gi 171060719 300 LLQAgg-----------------------------------pgSLTHVLLNrgwvpferv-------------------- 324
gi 168004169 312 ITDAlnrtfcdsmesrnc------------ddpcpsldhspsdYITVMLVPeggdi------------------------ 355
gi 148908973 373 ICDAlnrkhgd--------------------------slkclnNPPNTYVNvmlvpegg--------------------- 405
gi 75097659  371 IADAlnrthgdtnirlknpt--------yidiqehhfcvqpgyYINTLLVPkdgeiavdlkqlseqgiydvvsisflhlf 442
gi 16944482  480 VADAgeq----------------------------------srRSDPTYQPrphdgqevggql---------------ar 510
gi 202953513 405 IVKSatyslses-----------------------rmtsniedVSNQIQWNkyithlfym-------------------- 441
gi 151944519 364 IIDSmsraiagyrqskg--------------vhsenddfewqdFITDIVYLkngei------------------------ 405
gi 211589176 378 IVSAgeesrgrgpiihsqdqsqtpattsvqenvrnyralpytnYVTHILHLdgpgtphv--------------------- 436
                        570       580       590       600
                 ....*....|....*....|....*....|....*....|....*....
Feature 1                                                         
2Q7X_B       276 ylvqvehdfVGLCXQv-sRVISsnflrl---enggaFHDGDLIVDELXR 320
gi 218152235 332 ---qeepdlAALEKFp-lKVIDrtlvs----desdgLIDPQLLAPILLE 372
gi 171060719 325 akgfrylheGVLPEGg-pGLLAddfed----pwhrgRHDAPKVVELLGE 368
gi 168004169 356 ----kidveNLTRMGi-aRVVTvdstid---eklgrIYEPKALIGALQV 396
gi 148908973 406 --qvpvdiqHLEAQGi-cRVIFvdsise---ekigtIFEPKSLIQVLAN 448
gi 75097659  443 pslcaqqtlTVTSTLl-qRVVEsvgdp-----khgiLFNPSSLINTLAG 485
gi 16944482  511 tgtapkvdvKELEGLg-iKCVRvegrvq--edgkevRYDEGGLGEALEG 556
gi 202953513 442 kdpkieverEYLESEkniSCIEvkre------ehqdYYDLNDLEVKLRH 484
gi 151944519 406 -----eideTIFEKHs-iRCHQiass------dkmeGEELEKALNQIGL 442
gi 211589176 437 --drerltrMGIETLr-lYGRKimakygdedtvigmQYDPNALVQAIEV 482

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap