Conserved Protein Domain Family
cPLA2_Fungal_PLB

?
cd07203: cPLA2_Fungal_PLB 
Fungal Phospholipase B-like; cPLA2 GrpIVA homologs; catalytic domain
Fungal phospholipase B are Group IV cPLA2 homologs. Aspergillus PLA2 is Ca-dependent, yet it does not contain a C2 domain. PLB deacylates both sn-1 and sn-2 chains of phospholipids and are abundantly expressed in fungi. It shows lysophospholipase (lysoPL) and transacylase activities. The active site residues from cPLA2 are also conserved in PLB. Like cPLA2, PLB also has a consensus sequence of Sm-X-Nu-Sm (Sm = small residue, X = any residue and Nu = nucleophile). It includes PLB1 from Schizosaccharomyces pombe, PLB2 from Candida glabrata, and PLB3 from Saccharomyces cerevisiae. PLB1, PLB2, and PLB3 show PLB and lysoPL activities; PLB3 is specific for phosphoinositides.
Statistics
?
PSSM-Id: 132842
View PSSM: cd07203
Aligned: 12 rows
Threshold Bit Score: 734.171
Threshold Setting Gi: 68052823
Created: 10-Feb-2009
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
 
Feature 1:active site [active site]
Evidence:
  • Comment:Based on Human Cytosolic Phospholipase A2 structure (1CJY)
  • Comment:catalytic mechanism proceeds through a serine-acyl intermediate using Ser-228 as the nucleophilic residue.
  • Comment:catalytic dyad is formed by Ser and Asp
  • Comment:an oxyanion hole is formed by two Gly residues that polarizes the sn-2 ester
  • Comment:Arg may play a role in substrate stabilization in the cleft

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                       
gi 2498780   30 PANVSCDEDiNLIRQASG------------PSDNETEWLKKRDVYTREALRSFLDRATsnfsdssl---vsqlfsnaSDI 94
gi 68052823  42 PWQVDCPSNvTWIRNATTg-----------LGTGERAYIEAREKLVQPAIEQMMAARGle---------------tpPRT 95
gi 48475033 110 PFNLTCPSKkTFIRTASE------------LSQQEKDYIHKRQETTNKNLIDFLSKRAnlsdfdak---sfindnapNHN 174
gi 730338    20 PTSVSCPASrPTVRSAAK------------LSTNETSWLEVRRGKTLSALKDFFGHVKvgdydvgay--ldkhsgnsSSL 85
gi 2498782   35 PGTVSCPDDiNLVREATS------------ISQNESAWLEKRNKVTSVALKDFLTRATanfsdssevlsklfndgnsENL 102
gi 48474672  70 PFNVTCSND-NLLRPASEg-----------LNEGEQSYINKRISKVNSELRSFISKTGlnvdld--------kvvnsSDG 129
gi 31076988  39 PFPSTNASYaPVIRSCDSseimvnslprgeLPDLENDFIEKRLSNANEALTTFLQSKNttadld-------lssivgDNG 111
gi 51704326  24 PQNVSCPDNaNFIRNAADg-----------LSPAEKEWLKKRDPITRDALQTFLRRAFanvsteit----salfndtENV 88
gi 38017157  51 PYYVDCPSDnIVESLSSNe-----------IPSAESEYLSTRSTITNTAMKDFLRNANlpglna--------dtlsgSEG 111
gi 48474712  63 PYTVACPSG-SLLRPASDg-----------LSTGEQEFVDKRVSKVNSALESFISKTGlkidtk--------svlndTDG 122
gi 67477337  53 PAVVDCPKTkPTLRKAVD------------LSNEEKNWLSIRRKNTIQPMRDLLKRANitgfdsetf--mneaanniSQL 118
gi 48429051  26 PGPVSCPSS-QLIRSGSQg-----------INPNEQSYINARYPIAKQALSKFLHNANlqnfdv--------dsflaHSN 85
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                ## #                                      #                            
gi 2498780   95 PRIAVACSGGGYRAMLSGAGMLAAMDNRTDGANeh-gLGGLLQSTTYLAGLSGGNWLVGTLAWNNWTSVQDIvnnmtedD 173
gi 68052823  96 PVIGVALAGGGYRAMLTGLGGIMGMMNESTEASqs-eTGGWLDGVSYWSGLSGGSWATGSFMSNGGQLPTTLl------E 168
gi 48475033 175 ITIGLSFSGGGYRAMLAGAGQILGLDGRYEDANkh-gLGGLLDSSTYVVGLSGGNWLVGSLALNDWLSVGDIvn---gkS 250
gi 730338    86 PNIGIAVSGGGWRALMNGAGAVKAFDSRTDNATatghLGGLLQSATYISGLSGGSWLLGSIYINNFTTVDKLqth--eaG 163
gi 2498782  103 PKIAVAVSGGGYRSMLTGAGVLAAMDNRTEGAYeh-gLGGLLQSTTYLSGASGGNWLVGTLALNNWTSVQDIlnnmqndD 181
gi 48474672 130 PRLGIAFSGGGLRAMVNGGGAFNAFDSRFESDSp---LSGLLQSAMYISGLSGGSWLVGSVAINNFTNITYLr------D 200
gi 31076988 112 PRLGIAVSGGGWRSMLFGGGALAALDSRSNETT----LGGLLQSAHYITGADGGSWLLSSLAVNEFRTIQNIs------K 181
gi 51704326  89 PKLGIAVAGGGYRAMFVGAGAFAAMDNRTDGANeh-gLGGLLQAATYMAGLSGGNWLTGTLAYNNFTSVQQIleegdkaD 167
gi 38017157 112 PSIGIALSGGGLRAMILGSGALSAMDARHDNHTv---LTGLLQASDYLVGTDGSAWTVGGIALNNFSTINDF-------S 181
gi 48474712 123 PRLGIAISGGGFPAMLTGAGAINAFDARNGNTTs---LGGILQSSMYLTGLSGGSWLVGSVAVNNFANITFLh------D 193
gi 67477337 119 PNVAIAISGGGYRALMNGAGFVAAADNRIQNTTgaggIGGLLQSSTYLAGLSGGGWLVGSLFSNNFSSIETLls----eN 194
gi 48429051  86 PTIGLAFSGGGYRAMLTGAGEISSLDSRTKTNTp--vLAGILQASSYIAGLSGGSWLVGSLASNNLNSVDDMl-----sQ 158
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                       
gi 2498780  174 SIWDISNSIINPGGfmi---vtTIKRWDHISDAVEGKQDAGFNVSLTDIWGRALSYNFFPSly--rGGVAYTWSTLRDVE 248
gi 68052823 169 NLWNIDSNLVFPDDg-------KLSFYTNLYTETNAKSDLGFPVQITDIWGLAIGSHVLPEpyqlsNTPNLTFSSLPSVV 241
gi 48475033 251 TIWQLQDSILNPSGmri---dkTIAYYYGLAQAVQAKEDAGFQTSVTDTWGRALSYQFFEEddsgtGGANITWSSIRNLS 327
gi 730338   164 SVWQFGNSIIEGPDaggiqlldSAGYYKDLADAVDGKKKAGFDTTLTDIWGRALSYQMFNAs---nGGLSYTWSSIADTP 240
gi 2498782  182 SIWDLSDSIVTPGGini---fkTAKRWDHISNAVESKQNADYNTSLADIWGRALAYNFFPSln--rGGIGLTWSSIRDFP 256
gi 48474672 201 NVWNLEHSVFAPHGdnv---ieNLNYYNDLRKEIDQKKHAGFDCSLTDLWGRALSRKLVDAe---rGGPGITYSSMRNQS 274
gi 31076988 182 SIWYTRLGIFFIEEthf---gdLKNYYTNVVDEVNQKAAAGFNVSLTDYWGRAIARHFVGQl---rGGPNLTYSSVQNAS 255
gi 51704326 168 AIWNITNSFLNPYDkdf---skTLARWTAIGSQVQGKRDAGFNVTITDLWSRALAYGWFPTlp--nAGAGLTWSSLRDNE 242
gi 38017157 182 KLWAFNHPLMYPKSai----vfNAHFYSSIMNEVAEKANAGFNISLSDYWGRVISRTLGDTt---yGFPNVSLSSITSQE 254
gi 48474712 194 DVWNLDHSLFAPYDda----feNFYIYQEWFEQVLQKKNAGFNVSITDLWGRALALKLVNPl---tGGANTTFSSVTNET 266
gi 67477337 195 KVWDFENSIFKGPKeaglstvnRIQYWSEVAKEVAKKKDAGFETSITDYWGRALSYQLIGAd---mGGPAYTFSSIAQTD 271
gi 48429051 159 GLWELTHSFLSYYGieh--pikQVEEWVNVGNQVASKRNANFNVSLTDIYGRLLSYPLLTNte--dEGDAYLWSDVTSAS 234
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                       
gi 2498780  249 VFQ-NGEMPFPISVADGRy----PGTQIIDLNATVFEFNPFEMGSWD-----PTLNAFTDVKYLGTKVSNGEPvnKGQCV 318
gi 68052823 242 AALgNASLPMPIIVAADRkr-reAGELVIAENATVWEFTPYEFGSWAfgsqyKSPGAFTPIEYLGTSVDDGSP--NGTCW 318
gi 48475033 328 SFQ-DHSMPYPIVVANGRt----PGTYIINENSTIFEISPYELGSWD-----PSLKSFSNIQYLGSSVNNGNPnnTDICV 397
gi 730338   241 EFQ-DGDYPMPFVVADGRn----PGELVIGSNSTVYEFNPWEFGTFD-----PTIFGFVPLEYLGSKFEGGSLpsNESCI 310
gi 2498782  257 VFQ-NAEMPFPISVADGRy----PGTKVINLNATVFEFNPFEMGSWD-----PSLNSFANVKYLGTNVSNGVPleRGKCT 326
gi 48474672 275 WFQ-NADYPYPIIVADSRl----EEETAIPANTSIFEFTAYEFGTWD-----NGIKAFIPMEYVGTHLLDGVPp-DKSCI 343
gi 31076988 256 WFQ-TAEYPYPLIVTQGLtgglpDGSNGTATNSSIYEISPYYLTSFD-----NNVRSYTPTQYLGTNYSNGTAv-DGKCV 328
gi 51704326 243 IFM-NGEMPMPISVADGRy----PGTTVINLNATVFEMTPFEIGSWD-----PSLNAFSDIKYLGTQVTDGKPe-TERCI 311
gi 38017157 255 WYR-NANFPYPIITFATQn----YGEDISNVNTTFFEASPNVFGTFD-----HGINSFIPTEYLGTTLNNGASs-NGSCV 323
gi 48474712 267 WFQ-DGEFPFPIIIADNVi----EGETVIPLNDTVFEFTPIEFGTWD-----TGVESFIPMEYTGTHLINGIPl-NESCV 335
gi 67477337 272 NFQ-KAETPFPILVADGRa----PGDTIISLNATNYEFNPFETGSWD-----PTVYGFAPTKYLGANFSNGVIpsGGKCV 341
gi 48429051 235 NFQ-SHQMPFPILISDGRa----PDTTIINLNSTVIELTPYEFGSWD-----PSLNEFVDTRYLGTKLDNGRP--TGKCY 302
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                       
gi 2498780  319 AGYDNTGFIMGTSSSLFNQFLLQINSTslpsfiknl--vtgflddlsEDEDDIAIYAPNPFKDtsy---iqDNFSKSISE 393
gi 68052823 319 KGFDQLSFVMGTSATLFNGAFLELNGTdsglltnl----itafladlGEDQADISRIPNSFSNy-------NSGENPIYN 387
gi 48475033 398 NNFDNAGFIMGTSSSLFNQILLQLDNYsinsiikmi--lekvltdvsDEEYDIAVYEPNPFFGa------dSAGIKSITT 469
gi 730338   311 RGFDSAGFVIGTSSSLFNQFLLQINTTslpsfikdv--fngilfdldKSQNDIASYDPNPFYKy-------NEHSSPYAA 381
gi 2498782  327 AGFDNAGFIMGTSSTLFNQFLLRINSThlpsfitrl--arhflkdlsQDFNDIAVYSPNPFKDtkf---ldSDYTTSIVD 401
gi 48474672 344 HNYDNAGFVMGTSATLFNSFLLDWNENvkkndtyyd--ilhailedlSKHQDDIAPYPNPYQNytt---snTSVVNAFEP 418
gi 31076988 329 TQFDNVGFLVGTSSTRYNEALIDVSLRqsrmsrrl-----gftlrhmRINGSSVSFYPNPYTDatdiagnaTAVSEDIVD 403
gi 51704326 312 NGFDDASFIMGTSSSLFNEFTMSNDSAvaytylntl--sstlvkgidKENNDIAMYAPNPFKGsky---vdSNYTTSIVD 386
gi 38017157 324 INYDNFGFMMGASSTYFNKIMRNFNDSstkngrii----qqylkgnfSENGQQIISIPNPFQGves---anSDAANNLGS 396
gi 48474712 336 RNFDNAGFLMGTSSNVFSGILPATNASltasnntfnn-avlsflemlAEDQLDVGLYPNPYQGygn--asnTTTTNPLEP 412
gi 67477337 342 EGLDQAGFVMGTSSTLFNQFLLANISSydgvpdvlieavtsvlkeigAKRDDVSQIIPNPFLDw-------NNRTNPNAD 414
gi 48429051 303 NGFDNAGFFMGTSSALFNEAVLSITEAnipsflkdii-ddilvdpilKSNIDVSAYNPNPFFKs-------SGSNTAISQ 374
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1              #                                                                        
gi 2498780  394 SDYLYLVDGGEDNQNIPLVPLvqDERNVDVIFALDNSADTdy-yWPDGASLVSTYERQFSSQGl----NMSFPYVPDkRT 468
gi 68052823 388 LTYITLVDAGETNQNIPLEPLlvPTRDVDAIVAFDSSYDSdy-iWPNGTALRTTYERAKILAEhe-ntRVLMPEVPSmNG 465
gi 48475033 470 NDTLYLCDGGEDLQNVPFYPLiqNKRGVDVIFAFDNSADTns-sWPNGTSIQETYKRQFSKQGk----GTPFPFAPDyKT 544
gi 730338   382 QKLLDVVDGGEDGQNVPLHPLiqPERHVDVIFAVDSSADTdy-fWPNGTSLVATYERSLNSSGia--nGTAFPAVPDqNT 458
gi 2498782  402 SDSLFLVDGGEDDENVPVLPLiqKERDVDIIFAVDNSADMrl-aWPDGSSLVHTYERQFVKQGq----GMSFPYVPDtNT 476
gi 48474672 419 YDTIDLVDGGEDRENIPLWPLlhPQRFVDVVFAIDSTYNDpy-gWPLGSSIVATYERVVTFNAnksvdVRGFPYIPDeNT 497
gi 31076988 404 TPYLDLFDGGYDGQNIPIWPLlqPERKLDVVFAFDSSGDTsn-fWPNGSSLVATYERVTQRASdavydVEDFVHVPTpET 482
gi 51704326 387 SDSLFLVDGGEDLQGIPFVPLlkQERDLDIIFAIDVDTETsd-nYPAGGPMMKTYERQFSKQGk----GMAFPYVPDmTT 461
gi 38017157 397 SSSLNLVDTFLTGEKIPLWPLlqKGRDVDVIVAVDNGDDSew-lWPNGNSLVQTYERVVAAQAagntnVKGFPYVPSqQS 475
gi 48474712 413 YPIIELIDGGSDSEGIPFWPLlhPQRDVDVIFAIDGGYQSatsgWPDGSSLVSTYERVLATNSs---gVRGFPYIPDtNT 489
gi 67477337 415 TLELDLVDGGEDLQNIPLNPLtqPVRAVDVIFAVDSSADVt--nWPNGTALRATYERTFGSISn----GTLFPSIPDdWT 488
gi 48429051 375 SKNLYLVDGGEDGQNIPISPL--LHRNVSAIFAFDNSNDVl--nWPDGTSLVKTYERQFSSQGn----GIAFPYVPDqYT 446
                       490       500       510       520       530       540       550       560
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                       
gi 2498780  469 FVNLGLADKPSFFGCDAQNltdl----------nyiPPLVVYIPNARHSYnSNTSTFKLSYTDDERLKMIKNGFEAATRg 538
gi 68052823 466 FVNGGYNSRPTFFGCNDTT-----------------TPVIIYIPSYPWSFaANTSTYQLSYENNEANEMLLNGMRSLTLn 528
gi 48475033 545 FLDKNMGDKPVFFGCNSSDledlvawhendkinvtdVPLVVYTSNTRMSYnSNFSTFKLSYSDQEKFGAIRNGFETVTRn 624
gi 730338   459 FINLGLSTRPSFFGCDSSNqt-------------gpSPLVVYIPNAPYSYhSNISTFQLSTDDAERDNIILNGYEVATMa 525
gi 2498782  477 FVNLGLNKKPTFFGCDANNltdl----------qyiPPLVVYLPNAEYSFnSNQSAFKLSYSESQRRSMIQNGFEIATRn 546
gi 48474672 498 IISLGLNTRPTFFGCDGKNttagnh-----dvdnntPPLLVYFPNYPWTYySNISTFTMSMDDKMANGILENAFMSTTQ- 571
gi 31076988 483 FVNLGLNANPTFFGCDGRNttrgdv-----pvdhntPPLVVYMPNTPWTMkSNLVDHRYRIANSEIQALIQNGFVATTQ- 556
gi 51704326 462 FVNLGLGGKPSFYGCDANNltdl----------eyiPPLIVYIPNSYHSFeSNVSTFKLNYNYSERVGMIRNAFEATTRn 531
gi 38017157 476 FVSLHFNDRPVFFGCDGRNttagnh-----tvtrdtPPLVIYLPNVPYNYfTNISTDRTYYTEDMIQQLLTNGLISSTV- 549
gi 48474712 490 FLALGLNTHPTFFGCDGRNttagnh-----tvnddtPPLVVYFPNYPWTMyANVTTYTVQLEDTLSSGMIENAAVAATQ- 563
gi 67477337 489 FINLGLNNRPSFFGCDVKNftlna--------nqkvPPLIVYVPNAPYTAlSNVSTFDPSYTMSQRNDIIGNGWNSATQg 560
gi 48429051 447 FRNLNLTSKPTFFGCDAKNltslt-------kdiydVPLVIYLANRPFTYwSNTSTFKLTYDDNERQGMISNGFEIATRs 519
                       570       580       590       600
                ....*....|....*....|....*....|....*....|....*....
Feature 1                                                        
gi 2498780  539 nlTDDSSFMGCVACAVMRRKQQSLNATLPEECSTCFTNYCWNGTIDDTP 587
gi 68052823 529 --HSVPTWPTCFACALTDRSFMYTSENRSTTCQECFDTWCWAGDDNTTE 575
gi 48475033 625 nlTDDENWSTCVGCAIIRRQQERLGEEQSDECKKCFQEYCWTGGFKDAA 673
gi 730338   526 nsTLDDNWTACVACAILSRSFERTGTTLPDICSQCFDRYCWNGTVNSTR 574
gi 2498782  547 nfTDDPEFMGCVGCAIIRRKQQALNITLPPECETCFKNYCWNGTLDTTP 595
gi 48474672 572 --NNNESFAVCLACAIIQRSLERKKLSTPTQCSSCFQEYCWDGTLATST 618
gi 31076988 557 --DNSTDFASCLACAVVQRSLERRNQSTSAACQQCFSQYCWNGTVDNTP 603
gi 51704326 532 nlTEDADYVTCVGCAIIRRKQQSLNLTLPDICDKCFTNYCWNGTIDNTP 580
gi 38017157 550 --DNDTYFGQCFACAVVKRTLERNNITASPECQQCYYNYCWSGLYDDSA 596
gi 48474712 564 --NNSDSFAVCVACALVQRSLERKNMSTPSQCASCFNQYCWNGTIASTT 610
gi 67477337 561 ngTLDSEWPTCVACAVISRSLDRLGRQTPAACKTCFERYCWNGTVNSKD 609
gi 48429051 520 sgSLDDEWAACVGCAIIRREQERQGIEQTEQCKRCFENYCWDGTIYKGE 568

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap