Conserved Protein Domain Family
Pat_ExoU_VipD_like

?
cd07207: Pat_ExoU_VipD_like 
ExoU and VipD-like proteins; homologus to patatin, cPLA2, and iPLA2
ExoU, a 74-kDa enzyme, is a potent virulence factor of Pseudomonas aeruginosa. One of the pathogenic mechanisms of P. aeruginosa is to induce cytotoxicity by the injection of effector proteins (e.g. ExoU) using the type III secretion (T3S) system. ExoU is homologus to patatin and also has the conserved catalytic residues of mammalian calcium-independent (iPLA2) and cytosolic (cPLA2) PLA2. In vitro, ExoU cytotoxity is blocked by the inhibitor of cytosolic and Ca2-independent phospholipase A2 (cPLA2 and iPLA2) enzymes, suggesting that phospholipase A2 inhibitors may represent a novel mode of treatment for acute P. aeruginosa infections. ExoU requires eukaryotic superoxide dismutase as a cofactor and cleaves phosphatidylcholine and phosphatidylethanolamine in vitro. VipD, a 69-kDa cytosolic protein, belongs to the members of Legionella pneumophila family and is homologus to ExoU from Pseudomonas. Even though VipD shows high sequence similarity with several functional regions of ExoU (e.g. oxyanion hole, active site serine, active site aspartate), it has been shown to have no phospholipase activity. This family includes ExoU from Pseudomonas aeruginosa and VipD of Legionella pneumophila.
Statistics
?
PSSM-Id: 132846
View PSSM: cd07207
Aligned: 32 rows
Threshold Bit Score: 155.13
Threshold Setting Gi: 170744419
Created: 2-Jan-2009
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
 
active sitenucleophile
Feature 1:active site [active site]
Evidence:
  • Comment:Based on the crystal structure of semet patatin (1OXW)
  • Comment:catalytic dyad is formed by Ser and Asp
  • Comment:oxyanion hole is formed by two Gly and one Arg

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1               ## #                          #                                           
gi 2429143    106 SLVLSGGGAKGaAYPGAMLALEEKGMldgirSMSGSSAGGITAALLASGMSPAAFktlsdkmdlislldssnkklklfqh 185
gi 15604391    64 YIAFSGGGAKGaIYSGVYEAAKKTGIldnvkAVAGSSVGAITAAVVALGTPPKRFeeiskntnlqtl------------- 130
gi 148358957  303 NLVFCGGGAKIfAHVGVWKALNEAGMkp--tKFAGSSAGAIMSLMCYLGYTADEIselfqhfkqe--------------- 365
gi 59800354    31 GLVLSGGGAKGiSYLGMIQALQERGKiknltHVSGASAGAMTASILAVGMDIKDIkkliegldit--------------- 95
gi 54294171    26 NLVFRGGGSKGiAYVGALQSLSEQGVlenieNVAGSSAGAMTAAIVACGGSADLMeyfcsansladfvdnrltkkllpks 105
gi 46447273   473 NLVIKGGGPKGiAYIAVLKKLEEHEAlknleRIAGTSSGAIFASLISVGYTSSEIrdildeidlnkildypddlrldiek 552
gi 148359782   24 RVVCSGGGAKGvVYPGSYKAMEDTGVfkgveELSGASAGAITSTMLALGMPSAVFrdkllttnlknlmgs---------- 93
gi 170744419   12 FVAFAGGGAKGlVHVGALKALETRAVdi--rGVAGTSAGAIVAALKASGFSADDMadpitgrtildelar---------- 79
gi 91782787     6 RVALSGSGFRLgAHLGALQAIVDAGYev--vELAGTSGGSIVSAMFAGGMKLADMhelcmqmdwspm------------- 70
gi 52842619    56 RIVFSGGGSRIlAHIGALDELTRHGLkf--tEFSGSSAGAMVAAFAYLGYNCSEIkqiiswfnedklldsplifnfnnik 133
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                         
gi 2429143    186 iss--------------------------eigaslkkglgnkiggfselllnvlprIDSRAEPLERLLRDETrkavlgqi 239
gi 15604391   131 --------------------------------------------fgkqgfsagmiqLNKDGKPLYDLIELIIkenignfl 166
gi 148358957  366 ----------------------------------------------hlvqfdidrnGLSDTHSLKTALDYAIankvrqiv 399
gi 59800354    96 -----------------------------------------------klldnsgvgFRARGDRFRNILDVIYmmqmkkhl 128
gi 54294171   106 ekslqadssv-----------dyssisheqkgsqldtesslaeaklvtkpskltfaIASKSAKLVEAMEHVMrmaifthf 174
gi 46447273   553 lkkvlldakeevgliqkkgvsnskfkiafnlifnwvdwwgipcdqkkilkeryasgGLCKGEYLRELIEKKLtekvekhq 632
gi 148359782   94 -----------------------------------------rigslfgtnppgvsaITRDGKPLEDFIRENIissvktni 132
gi 170744419   80 -----------------------------------------idaalstapalfgegGWARVARLRALLRCGLarvavaaa 118
gi 91782787    71 --------------------------------------------mrfspwavvrhqSLCTGNALQAFLEQSThgktf--- 103
gi 52842619   134 qifnk----------------------gglssaklmrqaanyvilkkvmdiisdekFKTRFAKFQNFLEENIyscpenit 191
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                         
gi 2429143    240 athpevarqptvaaia-----------------------------------------------------------srlqs 260
gi 15604391   167 hrsdivnvqndkdldelr-------------------------------------------------------erynqkd 191
gi 148358957  400 nkykipypkgk--------------------------------------------------------------------- 410
gi 59800354   129 esvqqpippeqqmnygilkqkialyedklsragivinnvddiinltksvkdlekldkalnsiptelkgakgeqlenprlt 208
gi 54294171   175 pesldnelnnvheklkaiedkgsaeyinfak------------------------------rqqvledtqkiinelhdpn 224
gi 46447273   633 gtkinhlt------------------------------------------------------------------------ 640
gi 148359782  133 asiekietiaasdqtlqdl-----------------------------------------------------laklktkf 159
gi 170744419  119 lsvtllllgsflcaamanvaaalilwglwlatcgivfr---------------riraglaglsrlerfkgalgrviaara 183
gi 91782787       --------------------------------------------------------------------------------
gi 52842619   192 fqtla--------------------------------------------------------------------------- 196
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                         
gi 2429143    261 gsgvtfgdldrlsayipqiKTLNITGTAMFEgrpqlv-vfnashTPDLEVAQAAHISGSFPGVFQKvslsdqpy---qag 336
gi 15604391   192 gkiyfkdiallrkydpvqyKDLVITATQQETsalti---fnsfdTPNVEIALACRASASIPIVFKPveid---------- 258
gi 148358957  411 itfstlaslreqfpdcgigKELIVTATNKRSgktiy---lsanrYPLLEVSEAVKISASFPVLYRDtlld---------- 477
gi 59800354   209 lgdlgrlrellpeenkhliKNLSVVVTNQTKheler---ysedtTPQQSIAQVVQWSGAHPVLFVPgrna---------- 275
gi 54294171   225 fdltfghlhtlhqydpqrfKELYVTGTDENGelrif----sheqDADMPVSIAVRVSASLPGVFDPviye---------- 290
gi 46447273   641 ---fgelrelikteknspfKHLYIVAAKLGPqhgvrifssedpnCDDIIISDAVRASMSIPIVFSPhtlckkvngmriqd 717
gi 148359782  160 pvitfgdlallnhhfpdkfKQLNMPAVEFPNgaiqv---fnstlTPDVEIALACRASASIPVILKPvtitin-------- 228
gi 170744419  184 fpaepdrivrlrdfdgghlLPLKIVGANLSTrqltl---fsaetTPDIAVADAVAASISIPIVFAPqrig---------- 250
gi 91782787   104 ---------------vdsaIDLKIIAADLLTerefl---fsrqtTPNVPIAMAARASASIPIVFPPvaca---------- 155
gi 52842619   197 -------rikeicpecelgEKLFITGTNLSTqkhev---fsidtTPSMALADAIIISANLPIAFERicyq---------- 256
                         330       340       350
                  ....*....|....*....|....*....|..
Feature 1                #                        
gi 2429143    337 vewteFQDGGVMINVPVpemidkNFDSGPLRR 368
gi 15604391   259 --gkkYVDGGYRDNIPTky---fKDNEPEFCT 285
gi 148358957  478 --geeHNDGGILSNFPTe----vFFDDHSTLL 503
gi 59800354   276 -kgeyIADGGILDNMPEi----eGLDREEVLC 302
gi 54294171   291 --grkYIDGGAANNLPVn----iFFNKEEAYT 316
gi 46447273   718 eslgtYVDGGILMNYPIg-----IFDKKKYKR 744
gi 148359782  229 gvekqFVDGGLYDNLPTd-----YFDLQEDGT 255
gi 170744419  251 --advFVDGGIVSNLPAw-----PFDEERALD 275
gi 91782787   156 --galLVDGGTCDNVPAsd--ltVDDVPRLGI 183
gi 52842619   257 --gnvYSDGGISNNLPAh-----CFSEKGHKT 281

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap