Conserved Protein Domain Family
Pat_PNPLA5-mammals

?
cd07223: Pat_PNPLA5-mammals 
Patatin-like phospholipase domain containing protein 5
PNPLA5, also known as GS2L (GS2-like), plays a role in regulation of adipocyte differentiation. PNPLA5 is expressed in brain tissue in high mRNA levels and low levels in liver tissue. There is no concrete evidence in support of the enzymatic activity of GS2L. This family includes patatin-like proteins: GS2L (GS2-like) and PNPLA5 (Patatin-like phospholipase domain-containing protein 5) reported exclusively in mammals.
Statistics
?
PSSM-Id: 132862
View PSSM: cd07223
Aligned: 4 rows
Threshold Bit Score: 844.577
Threshold Setting Gi: 73969341
Created: 12-Feb-2009
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
 
active sitenucleophile
Feature 1:active site [active site]
Evidence:
  • Comment:Based on the crystal structure of semet patatin (1OXW)
  • Comment:catalytic dyad is formed by Ser and Asp
  • Comment:oxyanion hole is formed by two Gly and one Arg

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                        ## #                            #                               
gi 74762442    1 MGFLEEEGRWNLSFSGAGYLGAHHVGATECLRQRAPRLLQGARRIYGSSSGALNAVSIVCGKSVDFCCSHLLGMVGQLER 80
gi 73969341    1 MRCYEDEGSWNLSFSGAGFLGFYHVGVTRCFRERVPRLLQGARRIYGSSSGALNAVSIIADQSLDFCCSNLLGMVKHLEQ 80
gi 194473648  21 MDFLEVEGGWSLSFSGSGYLGLYHVGATECLRQRAPRLIQGARRFYGSSSGALNALSIICGKSADFTCSNLLAMVKHVER 100
gi 115749409   1 MDFLEAEGGWNLSFSGSGYMGLYHVGVTQCLRQRAPRLIQGARRFYGSSSGALNAMAIVFGKSADFACSNLLDLVKLVER 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
gi 74762442   81 LSLSILHPAYAPIEHVKQQLQDALPPDAHVLASQRLGISLTRWPDGRNFLVTDFATCDELIQALVCTLYFPFYCGlIPPE 160
gi 73969341   81 LSLGIFHPAFAPIEHIRQQLQESLPPNIHILASQRLGISMTRWSDGRNIIVTNFATRNEVIQALICTVYFPFYCGiIPPE 160
gi 194473648 101 LSLGIFHPAYGPIEHIKKKLQDDLPDNSHIVASQRLGISLTRWPDGQNFIVTDFATRDELIQALVCTLYFPFYCGtIPPA 180
gi 115749409  81 LSLGIFHPAYGPAEHIRKKLYENLPDNCHILASQRLGISMTRWPDGKNFIVTDFATRDEFIQALICTLYLPLYCGvIPPA 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1               #                                                                        
gi 74762442  161 FRGERYIDGALSNNLPFADCPSTITVSPFHGTVDICPQstspnlhelnvFNFSFQISTENFFLGLICLIPPSlEVVADNC 240
gi 73969341  161 FRGERYIDGALSNHLPFSDSPSTITVSPFHGTVDICPQstsanihelnaFNASLQISTKNFFLGFSCLISPNsEVAADNC 240
gi 194473648 181 FRGERFIDGALSNNLPFSNCPTTITVSPFNGTVDICPQstssslfeltaFNASFQISTRNFFLGFKSLFPPKpEVVADYC 260
gi 115749409 161 FRGQRFIDGALSNNLPFSDCPTTITVSPFNGTVDICPQnishslfeltaFNASFQISTRNFFRGLKSVFPPKpEVVADHC 240
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
gi 74762442  241 RQGYLDALRFLERRGLTKEPVLWtLVSKEPPAPADGnwdagcdqrwkgglslnWKVPHVQVKDVPNFeqLSPELEAALKK 320
gi 73969341  241 RQGYLDALRFLERRGLTKEPVLWmLVSKEPPAPADGsqdtghnrgqegglslnWAVPNVLVKDVPNFeqLSPELEAALQK 320
gi 194473648 261 RQGYLDALRFLERRGLTKEPVLWsLVSKEPPALVEGprgtdhnqgqeaglivrWDIPNVLVKDVPNFelLSPELEAALKK 340
gi 115749409 241 RQGYLDALRFLERRGLTKEPVLWsLVSKEPPALVEGprgtghdqgqktgptvrWDIPNVLVKDVPNFelLSPELEAALRK 320
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
gi 74762442  321 ACTrdpsrwarfwhsgpgqvLTYLLLPCTLPFEYIYFRSRRLvvwlpdvpaDLWWMQGLLRNMALEvfsrtkaQLLGPIS 400
gi 73969341  321 ACTrdastwarfcrsrpgraLTYLLLPCTLPFEYIYFRSKRLvawlpdmpaDVWWMQGVLQSLAAEiytrskdQLLRLVS 400
gi 194473648 341 ACKrdfwaqiq--csvpgkvLTYLLLPCTLPFEYAYFRSRRLmqwlpevpdDLYWMQGLLKTTTLKvysmaksWLLSLGS 418
gi 115749409 321 ACKrdfwtrvq--csvpgkvLAYLLLPCTLPFEYAYFRSRRLmewlpeapdDLDWMRSILKSTTLEvysmaksWLLRLGS 398

                 ....*
Feature 1             
gi 74762442  401 PPATR 405
gi 73969341  401 LPVTS 405
gi 194473648 419 PLVTS 423
gi 115749409 399 PPGTR 403

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap