Conserved Protein Domain Family
Pat_TGL3_like

?
cd07229: Pat_TGL3_like 
Triacylglycerol lipase 3
Triacylglycerol lipase 3 (TGL3) are responsible for all the TAG lipase activity of the lipid particle. Triacylglycerol (TAG) lipases are also necessary for the mobilization of TAG stored in lipid particles. TGL3 contains the consensus sequence motif GXSXG, which is found in lipolytic enzymes. This family includes Tgl3p from Saccharomyces cerevisiae.
Statistics
?
PSSM-Id: 132867
View PSSM: cd07229
Aligned: 19 rows
Threshold Bit Score: 414.006
Threshold Setting Gi: 146099622
Created: 18-Feb-2009
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
 
active sitenucleophile
Feature 1:active site [active site]
Evidence:
  • Comment:Based on the crystal structure of semet patatin (1OXW)
  • Comment:catalytic dyad is formed by Ser and Asp
  • Comment:oxyanion hole is formed by two Gly and one Arg

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
gi 74626314  104 KSVYPMLMFLRSSLLRNFGNIGNsSLYTENYSGTKILIEEYVREVnnclefly------------------------htk 159
gi 71409928   98 GDAEVLLAVLSTGLQRSVFGITN-PNLYRYLSGTKAVIEAYNSLLvyl-------------------------------- 144
gi 119184817 148 DDPRVVCNTIRTGLIRNMVNIAVpELYNKAFAGTKDLIESYAAQQvislryvmqlq-----------------tspphht 210
gi 212001741 105 KNDRAIMCTLRSGFIRNLGNLGDpSLFTRTYYGTKILIEDYVHETckclhsvr------------------------msk 160
gi 154288280 157 NDIWVIVHLIRSGLVRNLVNITSpQLYDCAYSGTKVLIEEYISEVglaieyiaale-----------------tvprdpk 219
gi 50550941  115 GDIATLISRLRSGLLRNLGSISSlQLYTRSYLGSKLLIEEYITEVidclkyikdygttggldtkgvhffpkseqrqldse 194
gi 190346340 124 QDSQLIMSLLRSGLVRNFGGIAQkRLFTKAYLGTKHNIEEYIEEVleclnylnesintp------------sdrenveyi 191
gi 39722369  129 ERIKEKFSTTGPCMLRNFAGIVDkKLFTKSLMGTKLLIEHHLDKTmegle-----------------------------l 179
gi 1730604   130 DVVKEKFSTTGPCMLRNFAGIGDkKLFTKSLMGTKLLIEQYLTRIlegldi----------------------------l 181
gi 156053051  98 GDILQLVNLLRSGLVRNLGNICApRLFNRAFAGTKLLIEDYITQVaqavadvtqlpttp-----------gadgndgsvk 166
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                             ## #                        #              
gi 74626314  160 rlsyDVKCDFFSAAR----------ISFGTTCLYFNGGTAFGLYHFGVAKTLWKRNLLPQILAGCASGALIASLLSVYRD 229
gi 71409928  145 --iqKLARDTSVDARkrystfmdvaRVYGSTALVFHGDMMLGQFHFGAAKALWKANLLPRFFYGGKTGALVSAFLCCKRN 222
gi 119184817 211 gfntQAKLDFIRGAR----------QGLGRSTLLFQGGSIFGACHIGVARALYREGLLPRVITGTATGAFVAALLCIRTD 280
gi 212001741 161 eiprIEKLEFFFAAK----------LSIGRTCLFFNGGTAYGLYHFGIAKALWERGLLPRVIAGSASGALIAALLGVYTK 230
gi 154288280 220 afdsQDKLRLLYDTR----------QAFGRSALILQGGAVYGTCHLGVVKALFLRGLLPRIITGTATGALVAALVAVHKD 289
gi 50550941  195 qltrQKKHKLFYDTR----------QSFGRTALVLQGGTIFGLTHLGTIKALTLQGLLPGIVTGFKEGAFIAALTGIYVS 264
gi 190346340 192 mnskQLKLDFFHDVR----------QSFGCTALVLQGGSLFGLCHLGVVKALYFKGLLPRIIGGSAVGAAVASLVCTLTD 261
gi 39722369  180 leanAAPTSFFQRCK----------LSLGTTALILQGGSFFGLFHLGVIKALLSQNLMPNIISGSSMGACIASIFGCLTN 249
gi 1730604   182 nnqtLTPTSFFQRCK----------LSLGTTALILQGGSLFGLFHLGVIRGLLLQDLMPNIISGSSMGACVASLFGCLSN 251
gi 156053051 167 gfssQAKLDLLHDTR----------QAFGRSTLVLQGGAIFGLCHLGVVKALFNRGLLPRIVTGTATGALIAALVGIHTE 236
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
gi 74626314  230 EELNGLFDTFPSElwkicq-----------------------------------------qtsdySLSKVVEYGNMLDIs 268
gi 71409928  223 LAEVFDVDEAAFStfskat----------------------------------------lglfdwRWQRLWNEGYFFNIh 262
gi 119184817 281 NELERFFEGEYLDimafeeprayhsldwfr-------------------ifshedgygwfqsllrRIIRCLNEHYFRDHi 341
gi 212001741 231 EEYPRMFSEFSSNlwetck-----------------------------------------ytvgfSLSKLLRYGNMLDIs 269
gi 154288280 290 DDLIPVLNGEGIDeavsdrlskqkhfkgwni----------------lsllardngygrlpslirRTEEYIRESYFPDLk 353
gi 50550941  265 DLELLETIDSLPDtlndlyqkykerlaeenkhkdhsfsnsnsdydfdyafdfeqfantynvtfssVTDKVLRSEYPPEVk 344
gi 190346340 262 EELIPILISIQDAmgdvdrlnh-----------------------------------dvderygnVIENVVKKGYSQDIl 306
gi 39722369  250 EELDHLLSGDTILdlirndlelvksc--------------------------gygdieqhvnlgkLIQNLVHHGYSQDVy 303
gi 1730604   252 EQLKQLLTDDNLLniikndvdllksc--------------------------gygnleqhlnlgtLIQNLIHHGYSQDVy 305
gi 156053051 237 DELPKFLNGESIDlsafagkerglq-----------------------------gssgwwdtltrRVRRFYREGYFLDVk 287
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
gi 74626314  269 MIASFVRq-rLGTITFQEAFERTGRIVNIVAPpsav------sgsPQVLNYFTAPNVLIWSAVCSSNSWAAIYr-----S 336
gi 71409928  263 VLVNFMRe-hLGDLTFLEAYQLTGRVLNIEYTpeavgvshkraplVRLLNYLTAPSVLVYSAVAASFASMPHFf----eR 337
gi 119184817 342 TLQNHVRa-aLRDITFEEAYSRTKRVLNITLAmsti------ggaPNLLNYITTPHVLIWSACLASNVSFAAEe-----E 409
gi 212001741 270 IILKTVRk-cTGNMTFQEAYDRTGRVINIVITpfaf------sgsPVVLNYLTAPDVLIWSAARTSNSWAPVFr-----S 337
gi 154288280 354 LLEEYVKs-tVGEMTFEEAFAKTKRCLNITIPtagr------agtPNLLNYLTAPNVLIWSAAAASNVSSATSs-----R 421
gi 50550941  345 MYEEFIEn-qLGDLTFEEAFNKSDRVLNIVAHshd-------ssfPTLMNYLTTPNVLIRSACRASMVTAHDEpqtkkaC 416
gi 190346340 307 VFLKFVRd-tIGDLTFEEAYLKTEKVLNIVVHpsh-------ssvPSLLNYITSPNVIIWTAIYASIGTGVLSd-----N 373
gi 39722369  304 LFIQFVLkyiVKDLTFEEAYQNTGKAFNIVIHpid-------nscPNLLNYVTTPNVLIRSAIECSLGTGVISt-----D 371
gi 1730604   306 LFIRFVMkyiVKEKTFEEVYQITGKVFNIVIHptd-------kscPNLLNYVTTPNVLIKSAIECSLGSGVISe-----D 373
gi 156053051 288 VLEECVRa-nVGDLTFEEAYNKTKRVLNITVAtsgk------ggvPNLLNYLTAPNVLIWSAALASNASTPSLyg---sS 357
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
gi 74626314  337 SPLLAKLpdgstevct---------------------------------------------------------------- 352
gi 71409928  338 YPLLAKDlngcv-------------------------------------------------------------------- 349
gi 119184817 410 VTIWCKSetgkivpwkp--------------------------------------------------------------v 427
gi 212001741 338 SKLITKQsdgslkscal--------------------------------------------------------------e 355
gi 154288280 422 VTLYCKDetgaivpwpd--------------------------------------------------------------a 439
gi 50550941  417 AHLLVKDddnsvipydacksrrgsstdvilgpvqeevdpldstangtnssgppkleittdtwkrnnaddedhvdtlpgrv 496
gi 190346340 374 VQLYVKDfnnnivpkepnipikfmkpqdv-------------------------------------sysqqyfrgfkknd 416
gi 39722369  372 TKLLCKDlgnevvsflefg----------------------------------------------------------npd 393
gi 1730604   374 TSLLCKNleneiepflnin----------------------------------------------------------knk 395
gi 156053051 358 VTLKCKDpstgtiipws-------------------------------------------------------------aa 376
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                  #                                                                     
gi 74626314  353 pknfiwpyAGLPNTGRSNPy-----aRISEIFNVNHFVITQSRPSLFPTFYDELHhhrvsgyslkmirlvglemay---- 423
gi 71409928  350 ---vpydpPVMGCVGKRSDgkvdgleRLRQLFHIKCFIVSECSFSQLPFLRLAGRtslparvwqafsqewwhlcl----- 421
gi 119184817 428 dnlnlhswHTFRCRSKESPl-----rRLPELLNVNHFIISQARPFIIPIFGEATHrpgakvlarrwkifhllytlskve- 501
gi 212001741 356 efvgsrpeRNAFFSSSAFA-------RISEIFNVNHFVITQSRPSLFPFISDELHhhsyhvywvkllrvlslslaf---- 424
gi 154288280 440 kgllfrswRELGYNERECPv-----sRLSELFNVNHFIIAQARPFRVPIYLPEVErpgkvvsrrgvlleqtcrvinlei- 513
gi 50550941  497 salptpsySMINQGKIVSPy-----aRLSELFNVNHFIVSLSRPYLAPLLAIEGRhrgyhgwrvnlirvlklefehrl-- 569
gi 190346340 417 hsdmersdGSRQNSKVESPy-----tRLTELFNVNHFINSLARPYLAPLISNDLKhyhsygkvrynfkslevdtnnddea 491
gi 39722369  394 tvqfvapeQATNLDEVESPy-----tRLTELFNVNNFIVSLAKPYLAPLVSNDLKheiktskyyyykh------------ 456
gi 1730604   396 qvkfltpeNANNPSITESPy-----tRLTELFNVNNFIVSLARPYLAPLVVNDLKheiktskyyyykhypnmppinantv 470
gi 156053051 377 adatfrpwTHASYTDRDSPl-----sRIAELFNVNHFIVSQARPYLVPFLQSDMHgpsrlytrggrtsltggllhlitme 451
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
gi 74626314  424 -------------------------------------------------------------rfrqldilgllpprlrrff 442
gi 71409928  422 ---------------------------------------------------------------ffvsfmpfqkylwafls 438
gi 119184817 502 ----------------------------------------------------------ircrlrqldsfyclpnllrsil 523
gi 212001741 425 -------------------------------------------------------------rmrqldllgfvpsklrrfv 443
gi 154288280 514 -----------------------------------------------------------rhrlrqldslgllptplrrll 534
gi 50550941  570 -----------------------------------------------------------aqfdyigllptifrrffiddk 590
gi 190346340 492 dvtfgylmdepqqsksfvidkrksfladpesytkdtsinlfknlknilglelqhrlevmnklgilsdvikrfcidekpav 571
gi 39722369  457 ----------------------------------------------------------------------ypqteesidi 466
gi 1730604   471 rktqrsssqs-------------------------------------pikagtvedlepeplmspvppssavndsaeyii 513
gi 156053051 452 ----------------------------------------------------------irhrleqldslqllplsirrfl 473
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
gi 74626314  443 vdDYVPSAYITLTPTFSf---sDIKHAFTKPSLSd--------------------------------------------- 474
gi 71409928  439 ngDIDAEDVIKVFPAASf---sDFITSFQLQPFSlk-------------------------------------------- 471
gi 119184817 524 ieENIPGSCIVLLPQISv---qDLTKVFNKPTRDt--------------------------------------------- 555
gi 212001741 444 lkDAVLSPHIILTPNFSf---sDIVHTFTEPSPDh--------------------------------------------- 475
gi 154288280 535 iyEDIEGPHMTILPELGw---mDLSKVFKPPPRAge-------------------------------------------- 567
gi 50550941  591 ipGIGPNAEVLIVPELAagmisDFKKAFSNHDIPe--------------------------------------------- 625
gi 190346340 572 apSLAGIREVSIVPELRyl-lrDFGRVFDVHKTMe--------------------------------------------- 605
gi 39722369  467 peLNIPQLNFTEMEPLAfkfkyHLERKLKNIATMefrhrmevldnlgllfpfikrliidertprsateiaivpkikslsi 546
gi 1730604   514 peLGIPQLNFTEMEPLAfkfkyHLERKLKNIATMefrhrmevldnlgllcslikrliidektprsateiavvprmkslsl 593
gi 156053051 474 vdEHIPAASVTLVPVLSa---gDFIRLLETPTKEs--------------------------------------------- 505
                        650       660       670       680
                 ....*....|....*....|....*....|....*....|....*..
Feature 1                                                       
gi 74626314  475 ----------IQYWILVGERATWQAIPLLQVRCKTEISLRHRMWKPI 511
gi 71409928  472 ---------eFQEHVLRGERGLWPFLERIREQLAAEFALNDALMQLR 509
gi 119184817 556 ----------LKHWVLKGERGVWPSMTYCDGAEGLAGELFKGGVALG 592
gi 212001741 476 ----------INYWILVGERTAWQAITLLRVRCKIELAIEKAEDSLF 512
gi 154288280 568 ---------eIRRWILKGERGTWPAIAAVRVRCTVEFALEKGYQVVK 605
gi 50550941  626 ---------kVRYWTTVGERATWPLVAAIWARTAIEYTLNDMYNQTK 663
gi 190346340 606 ---------nIPYWVLVGERSVWPLFPLLWVRCSIEFTLDDLYNSHR 643
gi 39722369  547 triiegqldnIPYWIKCGEQSTWPVLSLLKTRCKVELKLNEIIKHRR 593
gi 1730604   594 triiegqlnnIPYWIKSGERSTWPALALIKTRCAVEFKLDDIIRARR 640
gi 156053051 506 ----------LDYWILRGEKSVWPAVGALKVRCAVETELDRGYQIVR 542

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap