1LQK,1NPB


Conserved Protein Domain Family
FosA

?
cd07244: FosA 
Click on image for an interactive view with Cn3D
fosfomycin resistant protein subfamily FosA
This subfamily family contains FosA, a fosfomycin resistant protein. FosA is a Mn(II) and K(+)-dependent glutathione transferase. Fosfomycin inhibits the enzyme UDP-N-acetylglucosamine-3-enolpyruvyltransferase (MurA), which catalyzes the first committed step in bacterial cell wall biosynthesis. FosA, catalyzes the addition of glutathione to the antibiotic fosfomycin, (1R,2S)-epoxypropylphosphonic acid, making it inactive. FosA is a Mn(II) dependent enzyme. It is evolutionarily related to glyoxalase I and type I extradiol dioxygenases.
Statistics
?
PSSM-Id: 319908
View PSSM: cd07244
Aligned: 22 rows
Threshold Bit Score: 202.127
Threshold Setting Gi: 653061068
Created: 20-Mar-2009
Updated: 18-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
 
Conserved site includes 3 residues -Click on image for an interactive view with Cn3D
Feature 1: Mn binding site [ion binding site], 3 residue positions
Conserved feature residue pattern:H H EClick to see conserved feature residue pattern help
Evidence:
  • Comment:Mn(II) binding site
  • Structure:1LQK_A; Mn(II) binding site of FosA from Pseudomonas aeruginosa
    View structure with Cn3D
  • Comment:Both Mn(II) and K+ are crucial for efficient catalysis.

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1           #                                                           #                
1LQK_A         4 GLNHLTLAVaDLPASIAFYRDlLGFRLEARWdQGAYLELGSLWLCLSrepqyg---gpaadYTHYAFGIAAADFARFAAQ 80
gi 70905568    4 GLNHITIAVsDLGRSLAFYTDiVGMLAHVRWdNGAYLSLGGVWFCLScdkvm-----pskdYSHIALDISEDDFASFLEK 78
gi 31559086    4 GINHITFSVrDLRASIEFYRDlLGMKLHVFWdTGAYLTAGNTWLCLSlgqpe-----pakdYTHVAFSVREGELLELRAK 78
gi 515423351   4 GINHITIAVsDLERSVAFYQQrLGMLLKVTWaKGAYLEVAGQWICLSvdraq-----psrdYSHIAFDISEQLFEQYSRS 78
gi 800950472   4 GINHLTLTVhDLRRSLQFYSElLCFTPLVRWrQGAYLQNQELWLCLNvgrpq-----paqdYSHIALTVEPNRFCELQQR 78
gi 497521740   4 GLNHITLSVsQLEHSLDFYQNlLGFKAHVKWdNGAYLSLPGLWLCLSlgrte-----svkdYTHFAFSLSESDYERLVIK 78
gi 654554176   4 GINHVTLAVsNLDASLKFYIGhLGFTGHVRWnTGAYLTLGDFWLCLSvdepc-----dksdYTHLALDIDEQAFDVMADK 78
gi 566042926  84 GFNHLTFSVsDLDRSIAFYSElLGFSGEVRWaTGAYLSYGNCWLCLSlgnvs-----ssqdYTHVAFSFDAAAMWHITQK 158
gi 557380913   4 GINHITLSVsNLMRSIEFYQN-LGAIAHVRWqSGAYLSFGELWLCLSiceqpssklnaqedYTHFALNIEPENFIEYRQK 82
gi 642907267  24 GINHVTLCVrDLDRSIPFYRDlLGCALRERWeKGAYLEAGSLWLCLEllpdsq--aisrrdDSHLAFTVEPAGFTPMCER 101
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|....*
Feature 1                                     #               
1LQK_A        81 LRAHGVREWKQNRSEGdSFYFLDPDGHRLEAHVGDLRSRLAACRQ 125
gi 70905568   79 LRRADVTEWKQNSSEGySVYFLDPDGNKLEAHSGSLQSRLSSLKD 123
gi 31559086   79 LKQAGVEEWKQNTSEGdSIYLLDPNGHRLELHCGTLATRLAELES 123
gi 515423351  79 LMASGVDLWKENKSEGdSMYILDPDGHKLEIHVGTLTSRLQKMRE 123
gi 800950472  79 LTAADVCFWQENSSEGsSLYFLDPDGHKLEAHVGDLGSRLAAIAQ 123
gi 497521740  79 LKQYGVKQWQENTSEGeSFYFLDPDGHKLELHLGSLETRLAELKT 123
gi 654554176  79 LRASGVKEWKDNRSEGrSIYILDPDGHKLEVHTGGLSQRLKSLKK 123
gi 566042926 159 DGFPSVTQWQKNTSEGdSLYLEDPDGHKLELHSGSLTTRLESLRK 203
gi 557380913  83 VERLELQHWQQNRSEGeSLYILDPDGHKLEVHVGSMQSRLNSLKA 127
gi 642907267 102 LLGKVTLWKQNRSEGD-SLYFLDPDGHKLEIHVGSLLTRLRSLHA 145

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap