3BQX,4PAV


Conserved Protein Domain Family
VOC_like

?
cd07251: VOC_like 
Click on image for an interactive view with Cn3D
uncharacterized subfamily of vicinal oxygen chelate (VOC) family
The vicinal oxygen chelate (VOC) superfamily is composed of structurally related proteins with paired beta.alpha.beta.beta.beta motifs that provide a metal coordination environment with two or three open or readily accessible coordination sites to promote direct electrophilic participation of the metal ion in catalysis. VOC domain is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping. The proteins of this family share three conserved metal binding amino acids with the type I extradiol dioxygenases, which shows no domain swapping.
Statistics
?
PSSM-Id: 319914
View PSSM: cd07251
Aligned: 13 rows
Threshold Bit Score: 143.204
Threshold Setting Gi: 817598711
Created: 23-Feb-2009
Updated: 18-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3BQX_A         8 VITLGIGDLEASARFYGEgfGWAPVFr------NPEIIFYQx--NGFVLATWLVQNLQEDVgvav---tsrpGSXALAHN 76
gi 223515723   7 VITLGVDDLERSLCFYRDglGFETEGiigqefeYGTVVFIQl-aAGLKLALWPRKSMSHDTglalg--pasaTEFTLGHN 83
gi 219551616   7 IITLGVEDLERSYQFYRQl-GFPSSRt-----pEDGIIFFKt--GGVCLALYPLAALAEDVsadkavtrkgfSGVTLAHN 78
gi 24216481    7 LITLGVRDLKKAVHFYEQglGFPKMKf------EGNVAFFTl--NGTWLALYPWEELAADAgvsae--gngfRGFTIAYN 76
gi 222440988   7 MITLIVPDIMTARAFFETglGWQVNAa-----pSPHVVFFQi--PGGVFALYDRNALEDEIgskvt--tapfGAMTLAWN 77
gi 19704309    6 CICLGVKNMEKSIKFYRDglGYKTNCke----nNPPVCFFDt--PGTKFELYPLDLLVKDIdesslkigsgfSGFTLAYN 79
gi 214030113   7 LITLGVPNVAEAAGFYEQl-GWRRADs------PDGVVAFDl--ISQTLGLYPLEALAEDIglpvs--elghGAMTLSYN 75
gi 27377631   14 VITLGVSDIRASIAFYDTl-GFSRRLka----tGEAVAFYDt--GGPVLALFHWGQLAADAvlpdkprptnfRGITLAWN 86
gi 15599714    8 LVTLGVADLARSSLYYQAl-GWQPSSd-----gNEQVVFLKg--RNLVLGLYGRSALAEDAqvedr--ptgfAAITLACN 77
gi 169629953   7 FVTVAATDLDATRHFYGAl-GWTPLLd-----vEGEIIFYQs-aPGQVLGFFLADKFNQDLaspgd--haqvSGITLAHN 77
gi 223500771  51 LVLLGVRDVARSARFYEAl-GWRRSPt-----sNDGFVKFNm--GGYAICLINRDDFARDAqatdt-dkpgfSGVALIHL 121
gi 146446769   7 SILLGVRDMDRAKRFYTEglGWKVQN-------DFGISVFFesdGASPVGFYSREGLAGQVgtdqe--gsgfSGLVLTYV 77
4PAV_A        26 WFNLHVQDLEKSAQFYKAl-GFKINRnp---qxLDKXVGIQi--GQTTVILIENKHFQNVSqqsl---ntepNEVXISLG 96
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|.
3BQX_A        77 VRAETEVAPLXERLVAAGGQLLRPADAPPHg-GLRGYVADPDGHIWEIAFN 126
gi 223515723  84 VLSAQEVDHVMAHAVSAGANILKPAHETFWg-GYAGYFQDPDGHVWEVVWN 133
gi 219551616  79 TRSREEVDQVLALAVQAGATLEKEAQDVFWg-GYSGYFSDPDGYLWEVAYG 128
gi 24216481   77 GQSKEEVDQVIAKAEKVGAKIVKRPQEVFWg-GYSGYFQDPEGFYWEVAWN 126
gi 222440988  78 AKARDDVDTMFAKAVAAGARSVKEPQEAFWg-GYSSYVEVPGRHLLEIAFN 127
gi 19704309   80 VEKKEDVDKVIELVKNAGGKIIKEPQNVFWg-GYHAYFSDLDNYFWEVVWG 129
gi 214030113  76 TRTVEEVAALLDKAEAAGATILRPAGEVFWg-GTIGYFRAPDGHIWEIAHN 125
gi 27377631   87 CATREEVDAVLAFAVDKGAALLKAAHETDYg-GYSGYFADPDGHPWEVVVA 136
gi 15599714   78 CASRDEVDRLFSAATAAGGQATKMPQEVFWg-GYSGYVADPDGHLWEIAYN 127
gi 169629953  78 VETPKQVNELSSTMAGAGGTILKPPQPGQFggVFHAHIQDPNGLIWEIAHN 128
gi 223500771 122 ARSADDVPRILARAAEAGGEIVKPATRTHW--GVAGYFKDPDGHLFEVDYE 170
gi 146446769  78 VRSETRVDEIMAEAAKAGAKVLKPADALPWg-GYGGTFADPEGYIWSLGYS 127
4PAV_A        97 VNTNEEVDQLVNKVKEAGGAVVQEPTVSQG--FYGAXFKDLDGHHFNFLVC 145
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap