3EY7,3HUH,3ZW5,3HNQ,3EY8


Conserved Protein Domain Family
GLOD5

?
cd07253: GLOD5 
Click on image for an interactive view with Cn3D
Human glyoxalase domain-containing protein 5 and similar proteins
Uncharacterized subfamily of VOC family contains human glyoxalase domain-containing protein 5 and similar proteins. The vicinal oxygen chelate (VOC) superfamily is composed of structurally related proteins with paired beta.alpha.beta.beta.beta motifs that provide a metal coordination environment with two or three open or readily accessible coordination sites to promote direct electrophilic participation of the metal ion in catalysis. VOC domain is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping. The proteins of this family share three conserved metal binding amino acids with the type I extradiol dioxygenases, which shows no domain swapping.
Statistics
?
PSSM-Id: 319916
View PSSM: cd07253
Aligned: 22 rows
Threshold Bit Score: 145.447
Threshold Setting Gi: 209586296
Created: 17-Feb-2009
Updated: 18-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
 
metal bindingdimer interface
Conserved site includes 3 residues -Click on image for an interactive view with Cn3D
Feature 1: metal binding site [ion binding site], 3 residue positions
Conserved feature residue pattern:H [DH] [DE]Click to see conserved feature residue pattern help
Evidence:
  • Structure:3EY7_A; metal binding site of a glyoxylase family protein.
    View structure with Cn3D

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1             #                                                                          
3EY7_A         8 ISHLDHLVLTVADIPTTTNFYEkvLGXKAVSFga--------gRIALEFGH-QKINLHQLGnefep-------------- 64
3HNQ_A        21 IDRIDHLVLTVSDISTTIRFYEevLGFSAVTFkq--------nRKALIFGA-QKINLHQQExefep-------------- 77
gi 74853262    3 IDRLDHLVLTVSDIEKTCNFYEniLGMKVITFgkd------neRKALTFGN-QKINLHKKGaefep-------------- 61
gi 168070070   4 INRLDHLVLTVSNIDQTCDFYSrvLGMRTVTFge--------gRKALHFGQ-QKINLHEAGkefep-------------- 60
gi 199432598   3 IESLDHLVLTVKNIEESIRFYTsvLGMQVESFkg--------nRKALRFGN-QKINLHEHGhefep-------------- 59
gi 196191812   9 IEQLDHLVLTVADISITCQFYQsvLGCKVIHFttgs----gdnRCALSIGNhQKINLHSAGsplqp-------------- 70
gi 159184804  10 LVGIDHVVFIVDDMTRALDFYRnvLGCTDGYSypa------lgMEQVWCGN-ALIVLWDVThpggtk------------- 69
gi 209586296  70 LQRIDHVVIRCKNFLLMFDFYHriIGATIDEPreehvnrfggsLTHLRAGT-SYIDLLAYDtnhlsedgkvavakmhagg 148
gi 26989288    6 IKHIDHLVLRVSDLPRSVAFYTelLGCTVSRVred------lgMVHLATGT-AMIDLVTLDgplgqpg------------ 66
gi 126700787   2 IKKIEHVVITNNNIENYINFYKk-FGFSSKEMs---------kKYKLNARN-VKINLNIKGykflp-------------- 56
                         90       100       110       120       130       140       150
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
Feature 1                             #                                                    #    
3EY7_A        65 -----------kaqnVRVGSADLCFITDTv-lSDAXKHVEDQGvtiXEGPVKRTGAQ-GAITSFYFRDPDGNLIEVSTY 130
3HNQ_A        78 -----------kasrPTPGSADLCFITSTp-iNDVVSEILQAGisiVEGPVERTGAT-GEIXSIYIRDPDGNLIEISQY 143
gi 74853262   62 -----------kallPTAGSADLCFITITp-lHEVITELFQKNitiEEGPCERTGALsKPILSVYIRDPDYNLIEISNY 128
gi 168070070  61 -----------kaksPMPGTADLCFITDDp-iPDVIRHLENCNvviEEGPVLRTGAL-GSITSVYLRDPDGNLIEISNY 126
gi 199432598  60 -----------kachPVPGSADLCFVASTs-iEEVADHLKKNDvtiIEGPVKRTGAI-GSITSLYIRDPDLNLIELSNY 125
gi 196191812  71 -----------aaryPQPGSADLCFLTQTp-lSQVVEHLQSCSisiISGPIRRTGTL-GPILSVYIRDPDDNLIEIANV 136
gi 159184804  70 ---------aappvaGGRNVDHICIATGPlnhDALRAHLAKFNv-tIEQEAFHGGAR-GMGYSFYFRDPFGNKIELKGP 137
gi 209586296 149 vgtetgtiddvtfssDSSTMDHLCLRVEPfneQQMLKYLEGEGvtiILSGEKRLGAD-GVGPSIYVRDPEGNVIELKGS 226
gi 26989288   67 ---------gaapgvEGRNLHHFCLRIEPfdeAALTAYLEAAGv-kVEPAEKRYGAE-GEGLSLYCYDPDGNQVELKGP 134
gi 126700787  57 -----------yvknLQASRDNLCFKINTn-iDEPKKYLEQNEiqiERGIVECTGVF-GNIKSIYLKKTNGNLIELSNH 122

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap