Conserved Protein Domain Family
PX_SNX30

?
cd07283: PX_SNX30 
The phosphoinositide binding Phox Homology domain of Sorting Nexin 30
The PX domain is a phosphoinositide (PI) binding module present in many proteins with diverse functions. Sorting nexins (SNXs) make up the largest group among PX domain containing proteins. They are involved in regulating membrane traffic and protein sorting in the endosomal system. The PX domain of SNXs binds PIs and targets the protein to PI-enriched membranes. SNXs differ from each other in PI-binding specificity and affinity, and the presence of other protein-protein interaction domains, which help determine subcellular localization and specific function in the endocytic pathway. Some SNXs are localized in early endosome structures such as clathrin-coated pits, while others are located in late structures of the endocytic pathway. SNX30 harbors a Bin/Amphiphysin/Rvs (BAR) domain, which detects membrane curvature, C-terminal to the PX domain, similar to the sorting nexins SNX1-2, SNX4-8, and SNX32. Both domains have been shown to determine the specific membrane-targeting of SNX1. The specific function of SNX30 has yet to be elucidated.
Statistics
?
PSSM-Id: 132816
View PSSM: cd07283
Aligned: 4 rows
Threshold Bit Score: 225.35
Threshold Setting Gi: 148227022
Created: 26-Jan-2009
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
 
phosphoinosit..
Feature 1:phosphoinositide binding site [chemical binding site]
Evidence:
  • Comment:A majority of PX domain containing proteins binds phosphatidylinositol-3-phosphate (PI3P) at this site. In some cases, other phosphoinositides, such as PI4P or PI(3,4)P2, are the preferred substrates.
  • Comment:based on the structures of phosphatidylinositol-3-phosphate bound to other members of this superfamily
  • Comment:Two basic residues are key in binding with phosphoinositides: one forms hydrogen bonds with the 3-phosphate of PI(3)P and another forms hydrogen bonds with the 4-and 5-hydroxyl groups of PI(3)P.

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                 ###                       ##           
gi 118104446  92 LFVTVDDPKKHVCTMETYITYRVTTKTTRAEFDLPEYSVRRRYQDFDWLRNKLEESQPTHLIPPLPEKFVVKGVVDRFSE 171
gi 148227022 106 LFVTVDDPKKHVCTMETYITYSVSTKTTRTEFDLPEYSVRRRYQDFDWLRNKLEETQPTHFIPPLPEKFVVKGVVDRFSE 185
gi 62955569   82 LFVTVDDPKKHVSTMETYITYRVCTKTTRTEFDLPEYSVRRRYQDFDWLRIKLEDSQPTHLIPPLPEKFVMKGVVDRFSE 161
gi 153791707  91 LFVIVDDPKKHVCTMETYITYRITTKSTRVEFDLPEYSVRRRYQDFDWLRSKLEESQPTHLIPPLPEKFVVKGVVDRFSE 170
                         90       100       110
                 ....*....|....*....|....*....|....*.
Feature 1             #                              
gi 118104446 172 EFVETRRKALDKFLKRITDHPVLSFNEHFNVFLTAK 207
gi 148227022 186 EFVETRRKALDKFLKRIADHPVLSFNEHFNVFLTAK 221
gi 62955569  162 EFVETRRKALDKFLKRVADHPVLSFNEHFNAFLSAK 197
gi 153791707 171 EFVETRRKALDKFLKRITDHPVLSFNEHFNIFLTAK 206

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap