Conserved Protein Domain Family
PX_SNX7

?
cd07284: PX_SNX7 
The phosphoinositide binding Phox Homology domain of Sorting Nexin 7
The PX domain is a phosphoinositide (PI) binding module present in many proteins with diverse functions. Sorting nexins (SNXs) make up the largest group among PX domain containing proteins. They are involved in regulating membrane traffic and protein sorting in the endosomal system. The PX domain of SNXs binds PIs and targets the protein to PI-enriched membranes. SNXs differ from each other in PI-binding specificity and affinity, and the presence of other protein-protein interaction domains, which help determine subcellular localization and specific function in the endocytic pathway. Some SNXs are localized in early endosome structures such as clathrin-coated pits, while others are located in late structures of the endocytic pathway. SNX7 harbors a Bin/Amphiphysin/Rvs (BAR) domain, which detects membrane curvature, C-terminal to the PX domain, similar to the sorting nexins SNX1-2, SNX4-6, SNX8, SNX30, and SNX32. Both domains have been shown to determine the specific membrane-targeting of SNX1. The specific function of SNX7 has yet to be elucidated.
Statistics
?
PSSM-Id: 132817
View PSSM: cd07284
Aligned: 4 rows
Threshold Bit Score: 234.101
Threshold Setting Gi: 49258174
Created: 26-Jan-2009
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
 
phosphoinosit..
Feature 1:phosphoinositide binding site [chemical binding site]
Evidence:
  • Comment:A majority of PX domain containing proteins binds phosphatidylinositol-3-phosphate (PI3P) at this site. In some cases, other phosphoinositides, such as PI4P or PI(3,4)P2, are the preferred substrates.
  • Comment:based on the structures of phosphatidylinositol-3-phosphate bound to other members of this superfamily
  • Comment:Two basic residues are key in binding with phosphoinositides: one forms hydrogen bonds with the 3-phosphate of PI(3)P and another forms hydrogen bonds with the 4-and 5-hydroxyl groups of PI(3)P.

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                ###                       ##           
gi 12643904  32 LFITVDEPESHVTTIETFITYRIITKTSRGEFDSSEFEVRRRYQDFLWLKGKLEEAHPTLIIPPLPEKFIVKGMVERFND 111
gi 50751270  92 LFITVDDPESHITAIETFITYRVVTKTSRGEFDSCEYEVRRRYQDFLWLKSKLEEAHPTLIIPPLPEKFVMKGMVERFSD 171
gi 89269915  84 IFITVDEPESHVNAIETFITYRIATKTSRSQFDSSEFEVRRRYQDFLWLKSRLEDAHPTLIIPPLPEKFIVRGMVERFTE 163
gi 49258174  58 IFVTVDNPESHVTAIETYITYRVMTKTTRSEFDSSEFEVRRRYQDFLWLKGRLEEAHPTLIVHPLPEKFVMKGMVERFNE 137
                        90       100       110
                ....*....|....*....|....*....|....*.
Feature 1            #                              
gi 12643904 112 DFIETRRKALHKFLNRIADHPTLTFNEDFKIFLTAQ 147
gi 50751270 172 EFIETRRKALHKFLNRIADHPTLTFNEDFKIFLTAQ 207
gi 89269915 164 EFIETRRKALHKFLNRIADHPTLTFNEDFKIFLTAQ 199
gi 49258174 138 DFIETRRRALHRFLNRIAEHPIFSSTEDFKIFLTAA 173

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap