Conserved Protein Domain Family
M48B_HtpX_like

?
cd07336: M48B_HtpX_like 
Peptidase M48 subfamily B HtpX-like membrane-bound metallopeptidase
This HtpX family of peptidase M48 subfamily B includes uncharacterized HtpX homologs and consists of proteins smaller than Ste24p, with homology restricted to the C-terminal half of Ste24p. HtpX expression is controlled by the Cpx stress response system, which senses abnormal membrane proteins. HtpX participates in the proteolytic quality control of these misfolded proteins by undergoing self-degradation and collaborating with FtsH, a membrane-bound and ATP-dependent protease, to eliminate them. HtpX, a zinc metalloprotease with an active site motif HEXXH, has an FtsH-like topology, and is capable of introducing endoproteolytic cleavages into SecY (also an FtsH substrate). However, HtpX does not have an ATPase activity and will only act against cytoplasmic regions of a target membrane protein. Thus, HtpX and FtsH have overlapping and/or complementary functions, which are especially important at high temperature; in E. coli and Xylella fastidiosa, HtpX is heat-inducible, while in Streptococcus gordonii it is not.
Statistics
?
PSSM-Id: 320695
View PSSM: cd07336
Aligned: 72 rows
Threshold Bit Score: 346.403
Threshold Setting Gi: 189036285
Created: 25-Feb-2009
Updated: 18-Aug-2016
Structure
?
Aligned Rows:
 
Zn binding siteputative active
Feature 1:Zn binding site [ion binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                         
gi 24212639    16 LTVVLVGIGYLLGGtgGMIIAFTLalFMNLISYWFSDSIVLNWYNARIVseeeAPELHYIVEKLARQAGIPKPRVAIVPT 95
gi 699052823   14 MTALILWVGQLLGGrqGMIIALIFaaGMNFFSYWYSDKLVLKMYRASEAtpnqAPELYGMVQQLTHQAGLPMPKLFIIPQ 93
gi 460789338   13 LIIVFMFFGGMIAGqdGIVMAFIFalAINFISYWNSDKIAIKMTKSKPLneseAPEIYNIVRKLTQNNKMPMPEIYLTPS 92
gi 667802539   38 LTALLLFVGERLGGpqGLVVAGFFvvVMNFGSYWFSDRIALAMHGARPLeyaeAPWLHQMVERLAARAGMPKPKLYLLPT 117
gi 523265307   13 MTLIVVFTAQALGF--SLISSLFFafLLNFIMYFNSAKIALASTKAKKIedgtYQEVKDIVEFLSQKEKMPAPQLYIIES 90
gi 319925234   13 MTLLLLGIGRAFGGsnGMTIALLIagIMNFVSYFYSDKIALRMSNAQPAtreqLPRVYAIVERLTQKQGLPMPKLYTLPD 92
gi 818462319   13 LSALMVLLGKTFGGqtGMLIMLGIslAMNFFGYWFSDKMVLKMTKAKPVskdkERELYHMVEEISHSAGIPVPKIYMTDD 92
gi 1037409118  16 LTGILVMMGQWAGGsvGMIFALGLavVMNFSAYWFSDKIVLRMYKASPVtaseAPRLHAITRNLVARAGLPMPALYVLPQ 95
gi 152029204   33 LIAILAIGGQMVGGtgGMLLFGAIglVFNLLSYWFSDRIALMAHRAQPVtreqLPDVYEIVERLTRKAGIPMPRVFVIPS 112
gi 406930285   14 LSVLLITVGGLLGGqeGIYMAFFFslLMNGAAYFFSDKLALKMSGAKPIkkrdYPQLFEIVEDLSRKMKIPMPKMYITPA 93
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                              #   #                                      
gi 24212639    96 MVPNAFATGRSPRNAVVAVTEGLLQLLNKDELEGVIAHEISHIKNRDTLIQTIAAVLAGAIMILVDFARWslwfgaydde 175
gi 699052823   94 DAPNAFATGRNPEHAVVAVTQGLLKIMDRDEVIGVLAHELAHVKNRDILIGSVAATMAGAIMILATMARWsaifgggshd 173
gi 460789338   93 NQPNAFATGRNPDHAAIAVTRGLIRLLNKDELEGVIAHELAHVKNRDTLISTMAAVMAGALAFLARIGRFrmifggrrn- 171
gi 667802539  118 RTPNAFATGRNPEHAAVAVTAGIVDILDQRELEGVLAHELAHVKNRDTLIGTVAATLAGVISYAAQMLFWfggsllsrdd 197
gi 523265307   91 DQPNAFATGRNPKNSAVAVTTGILKVLNRDELEGVLAHELSHIKNNDILVSSIAAMLAAAISFMSRMYFWgggrrdr--- 167
gi 319925234   93 NSANAFATGRNPEHASVAVTQGILQLLDDEELEGVLAHELSHVRNRDILTASIAATLAGAITWIAHIGRWgmifggyggr 172
gi 818462319   93 MQPNAFATGRNHNHAVVAVTRGLMELVDKNELKGVIAHEIAHVKNRDILIGSVAAMMAGVISYLAQIAQWgamfggfggd 172
gi 1037409118  96 DAPNAFATGRNPAHSAVAVTRGLMQSMNDDELAGVVAHELAHIKNRDILTASIAATIAGAVSMLASMFQWmaifgggghr 175
gi 152029204  113 ATPNAFATGRNPSHSAVAVTQGILGILDKRQLEGVLAHELAHVRNRDVLIATIAAAVAGLIASLGHMIQWgaifggfggr 192
gi 406930285   94 AQANAFATGRDPSHASVAVTKGIMNILSKEELKGVLAHELSHVKNRDILVASVAAVIASAISFLANMSLFgafsrgdn-- 171
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                           #                                             
gi 24212639   176 ---rdsgsviglILAIILAPLAATlIQLAISRSREYLADETGARISgkpHALASALMKIEeavryrplrrgNPATA---H 249
gi 699052823  174 e-egggagfiglIIMSIIAPMAAMiVQMAISRSREYLADATGARFAghpEGLAKALEKLGayskr-lpmdaNPSTA---H 248
gi 460789338  172 ---nngagallqLVAIIFAPLAAIlIKMAISRSREYIADETGGKISgnpEGLASALEKMErysqgkeqmqiNEAAA---H 245
gi 667802539  198 d-edglghalgnLGVLLVAPIAATlLQLAVSRSREYGADATGAELCgdpDALASALMKLErgael-mpydrAPATS---H 272
gi 523265307  168 -----nghpaiiLIAFIAAPIASLiIRMAISRTREYGADKTGSLISgnpLALASALEKIEmyskn--pldvNPAVSqlfI 240
gi 319925234  173 dsrdrngggigaLFMLILAPIAATlIQLWVSRTREYEADASGAAMTgnpYALARALQKIGaasar-vptfaSANTAh--M 249
gi 818462319  173 d-eedggnivgtLVLAIVAPIAAMlVQMAISRSREFHADATGASFAkdtQGLSSALEKLEvaskripmrhaNPSTA---H 248
gi 1037409118 176 --dgegahplalLGMALIAPIAAGiVQMSVSRSREYAADATGAEIAgspYGLASALEKLGrysqr-vptraTAATS---H 249
gi 152029204  193 s-ddergnvfaaLAWALLAPIIALiVQLAVSRSREFGADASGAELTgdpDALAEALLALErgnevrpyaygGPATAh-lF 270
gi 406930285  172 ----rggagafgLLIAILVPIAASiIQLAISRQREYGADETGARLIgngEPLARALIAIHdstrr-aplatNPAYSs-lY 245
                         250       260       270
                  ....*....|....*....|....*....|..
Feature 1                           #             
gi 24212639   250 MFIINPFRGIDFAELFSTHPPTEKRIERLRKI 281
gi 699052823  249 MFIVNPLSGKRMMSLFSTHPPLEERIARLRGT 280
gi 460789338  246 MFILNPLSREGMAKLFSSHPPTAERIKRLRQT 277
gi 667802539  273 LFIVNPLSGGAIMGLFSTHPPIPERVRRLREM 304
gi 523265307  241 SNPLKSFSGSGLGKLFSTHPPTKERVRRLREG 272
gi 319925234  250 FINAPRISGADFASLFSTHPPMAKRIERLIGR 281
gi 818462319  249 MYISNPLRGRGMLSLFSTHPTTKARVEKLRAL 280
gi 1037409118 250 MFIVMPLSLGQFRGLFATHPPIEERIRRLVGG 281
gi 152029204  271 IVNPFRGAGGKMLQLFSTHPPIEARVERLRQM 302
gi 406930285  246 ISNPLGGLGGGLTKLFSTHPPVEERVKRLRNI 277

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap