Conserved Protein Domain Family
M48B_HtpX_like

?
cd07338: M48B_HtpX_like 
Peptidase M48 subfamily B HtpX-like membrane-bound metallopeptidase
This HtpX family of peptidase M48 subfamily B includes uncharacterized HtpX homologs and consists of proteins smaller than Ste24p, with homology restricted to the C-terminal half of Ste24p. HtpX expression is controlled by the Cpx stress response system, which senses abnormal membrane proteins. HtpX participates in the proteolytic quality control of these misfolded proteins by undergoing self-degradation and collaborating with FtsH, a membrane-bound and ATP-dependent protease, to eliminate them. HtpX, a zinc metalloprotease with an active site motif HEXXH, has an FtsH-like topology, and is capable of introducing endoproteolytic cleavages into SecY (also an FtsH substrate). However, HtpX does not have an ATPase activity and will only act against cytoplasmic regions of a target membrane protein. Thus, HtpX and FtsH have overlapping and/or complementary functions, which are especially important at high temperature; in E. coli and Xylella fastidiosa, HtpX is heat-inducible, while in Streptococcus gordonii it is not.
Statistics
?
PSSM-Id: 320697
View PSSM: cd07338
Aligned: 36 rows
Threshold Bit Score: 206.278
Threshold Setting Gi: 442790629
Created: 25-Feb-2009
Updated: 18-Aug-2016
Structure
?
Aligned Rows:
 
Zn binding siteputative active
Feature 1:Zn binding site [ion binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
gi 150421574  40 LLALAMVLVQWLFSPYIINmvyrtre---------plpgeeWIVAEVEQLARRSGLKPPKVVVSEMnmPNAFAYGSpi-a 109
gi 630829283  40 ILASFMMFIQYMLGPKMVEwsmgvky--------vneqeypALHRMVAELARDARIPKPKIGIARIpiPNAFAFGRwa-k 110
gi 785770130  40 GMGIFMGLIQWLIGPKIIRwstnlrt--------lspgelpWVEQTVREICAKNNVKVPQITIANNgmPNAFVFGRts-n 110
gi 255513721  49 LVALAYFIIQWYVSPKILAaasklhy--------itgneypQIQQFVKSAADSAKVPVPRIAIAPAkdPNAFVFGRtr-r 119
gi 816391227  38 GFTLLIILFQYGISPLIVGwlysidwip----yeefarqypHLADSLDKVVAVNGIKVPRLGIIHDlnPNAFTFGWsk-n 112
gi 28203295   43 GFSVSIALIQFLLGPFIIEtfygilfd------dydsyiseDVLRFIEKSCDGYNISHPKIGIIEDgnPNAFTFGHip-r 115
gi 765351125  29 AGGVSVVAVQYLVAPWVIAwlvpatelar---tadgyrsdePVAAIVARQCQAAGLPLVRLGIVDDgdPNAFTFGRtr-r 104
gi 663075502  20 GFAILMVLLQYALGPVVIDavvkirwt-------spmelgpDFDLWLRQTCATFKIPTPKFGIIEEgsPNAFTYGNgp-w 91
gi 442790629 286 IVTVLINLIVFWLSPQIIDfiqarlysirwvpiteigyhssETAEVIERICSKYQLKTPRLGVIDQpiPIAFSYGAfphh 365
gi 518931897  40 VLVLIINAVIFFISPWITDwmlrwvnkvefiddatlksrypHVHGIIHDVAREYRFKAPSVGIIPDrnPTAFTYGLfr-p 118
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                #   #                                                   
gi 150421574 110 GSYVAVTRGLLrllpkDEVRAVLAHEVGHLKHRDVTVILALS-LIPIAAFLIGRTLVwagilggggg----errgnpmal 184
gi 630829283 111 DGRVCVTEGIMnllneRELRAVLAHEVSHLKHRDVAVITMIS-VIPMIAWYLAWNSLfsggrd-------------rgnn 176
gi 785770130 111 SATLALTQGLLnnltqDEVKGVIAHEIGHIKHHDMLVMTIVS-VVPTIAYYIAMSTMfsgrshr----------nqvgga 179
gi 255513721 120 SATLVIHEGLLarlnsDELKAVIEHEIGHLRHNDVIIMTMVA-FIPMLAFIIAQNILwagmfnds--------rnsssyi 190
gi 816391227 113 SARVVITDGILeylneKEQNAVFSHELGHVVHSDFIIMTIVF-AIPLVLLTVARWAYyagwysgrrrssddegnllglil 191
gi 28203295  116 NARLVVTTGLLdilneEEQKAVIAHELGHIKHYDFITMMIVS-LIPMILYQIYLRTKekka----------------dak 178
gi 765351125 105 DSRVWISRGLLdrlddREVEAVVAHELGHVAHRDVAVMTVAS-LIPMVLYFATAGGRaangs---------------ggn 168
gi 663075502  92 NARVVVTRGVIdalepEELKAVVAHELGHVRNRDFIVMTIVQ-ALVLALYSLYIASRyagr----------------rng 154
gi 442790629 366 QTRLVVSQGLFayldeEEIATVYAHELGHIVNKDLMIMTLGYgFMAIINLIRARWDKpl--------------------- 424
gi 518931897 119 GARIVLTDGIFeflneEETRAVVAHELGHIVNRDFLVMTVAG-TLVQMLYVIYSSLTrqtrssgs--------sksknnl 189
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                 #                                                      
gi 150421574 185 vAVGAALLAAGMVFQlivshFNRLREYYADAHSALVTGsprsLQRALARIHAAYehnphlveearsnemasmlfivapl- 263
gi 630829283 177 iLIGIAAFAVYFLTNllvlyVSRIREYSADEGAVKLGNsphqLASALYKLVYGSaripkeslkqvegmkaffasdpsras 256
gi 785770130 180 aMIGIGAFVVYFITNlmvlhFSRLREFYADRFAGQQIKpt-hLASALAKITYGLsiqkqnmqnsslrafyavdpvassle 258
gi 255513721 191 mLLGVVAFIVYFVAEmlmlsLSRARESYADSYSASATKkpgdLASALLKITASGaaapassnnstvarslyivdffnvek 270
gi 816391227 192 iAVAVLAYISYYLGYlisliVSRIREYYADEHSAEVLEdpnaLATGLVKIAYGLlmdanngqvkernrsrvralrglgif 271
gi 28203295  179 yIVGLGAYAAYLLSGflvlgFSRMREYYSDNFAKEVMGdgehLRNALVKIAYGTasrekdknpkascmaftnnvqndswm 258
gi 765351125 169 dVNRLLAFAAYLVAQlallgFARARELGADHASCRATGdgdaLCSALVRIAYGIdevgreraariaalraddekrqarrl 248
gi 663075502 155 gYVAVLSFIAYQLSYyisllLSRVREYMADYASAQIMSngndLSSALVKIAYGMgrlqtaspaqqpvsyspqpypspayq 234
gi 442790629 425 fPAFIYTLATYSLFY-----LSRTREYHADHIATQITGnpnaLIRALTKIAYGIveenersekvsnllretrvlgiydpy 499
gi 518931897 190 aIVGFAAYVMYVLGTyillyLSRTREYLADSFAADRVEar-hLANALVKIAYGIaeaadtdqtrellastrhmgvvdfkg 268
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
gi 150421574     --------------------------------------------------------------------------------
gi 630829283 257 reirel-------------------------------------------------------------------------- 262
gi 785770130 259 vsr----------------------------------------------------------------------------- 261
gi 255513721 271 dikdlk-------------------------------------------------------------------------- 276
gi 816391227 272 dpnaak-------------------------------------------------------------------------- 277
gi 28203295  259 l------------------------------------------------------------------------------- 259
gi 765351125 249 arrgarlrstga-------------------------------------------------------------------- 260
gi 663075502 235 avatarpgqiilppvgvnqappvqpapppamgndrvtpdlmaklasiqhqgdvrsgaaasqdfaaqllggqaqaragkqp 314
gi 442790629 500 l------------------------------------------------------------------------------- 500
gi 518931897 269 ash----------------------------------------------------------------------------- 271
                        330       340       350       360       370       380       390
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
Feature 1                                                                      #            
gi 150421574 264 ------------------------------tsltasplvdvdylverlkeqetnpLVELFSTHPPvsKRLRFLDR 308
gi 630829283 263 ------------------------sqidldgsgtidatelaalrtrpikvntadkLMEMLSTHPNmlKRIQRLSS 313
gi 785770130 262 --------------------------fasyyldlhisekevqdamdwerrnsfskFGELFRTHPLtyKRIAKLYE 310
gi 255513721 277 -----------------------thineikelvpdidinrlvsearknrggplnaLNSMFATHPPtyKRIVDLAR 328
gi 816391227 278 -----------------------glgiisvsstkvlsmeaiqaaaawdlfnpwakYYQFRSTHPLpaKRIMRLNA 329
gi 28203295  260 -----------------------------styklddnnkmklnlmkwdlknpwakWYEINSTHPLtgKRIMALDH 305
gi 765351125 261 -----------------lgiagpgglpaagllgpglpperiaaamrwentspwarWQELFATHPLvvHRIAALER 318
gi 663075502 315 knpapsfdaralgafgiagaasmrsavtwggqqgtvdpdhftmgarwelynpwarIAELVSTHPLtvRRIQALQK 389
gi 442790629 501 ----------------------------alatgivteaknlgktlvwdmfnpwanWVQLNATHPLtgKRFAALTD 547
gi 518931897 272 --------------------------lglvveasklhpeatanamlfdiynpwakLIELSSTHPLtgKRINALAA 320

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap