1YJE,2QW4


Conserved Protein Domain Family
NR_LBD_NGFI-B

?
cd07348: NR_LBD_NGFI-B 
Click on image for an interactive view with Cn3D
The ligand binding domain of Nurr1, a member of conserved family of nuclear receptors
The ligand binding domain of Nerve growth factor-induced-B (NGFI-B): NGFI-B is a member of the nuclear#steroid receptor superfamily. NGFI-B is classified as an orphan receptor because no ligand has yet been identified. NGFI-B is an early immediate gene product of the embryo development that is rapidly produced in response to a variety of cellular signals including nerve growth factor. It is involved in T-cell-mediated apoptosis, as well as neuronal differentiation and function. NGFI-B regulates transcription by binding to a specific DNA target upstream of its target genes and regulating the rate of transcriptional initiation. Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, NGFI-B has a central well conserved DNA binding domain (DBD), a variable N-terminal domain, a flexible hinge and a C-terminal ligand binding domain (LBD).
Statistics
?
PSSM-Id: 132762
View PSSM: cd07348
Aligned: 6 rows
Threshold Bit Score: 473.161
Threshold Setting Gi: 47229201
Created: 2-Apr-2009
Updated: 17-Jan-2013
Structure
?
Program:
Drawing:
Aligned Rows:
 
putativeheterodimer
Conserved site includes 13 residues -Click on image for an interactive view with Cn3D
Feature 1:putative coactivator recognition site
Evidence:
  • Comment:putative coactivator binding site, based on structural homology to other members of the family

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                             #  #   #    #    ## ##  ##
1YJE_A       27 PTNLLTSLIRAHLDSGPNTAKLDYSKFQElvlprfgKEDAGDVQQFYDLLSGSLDVIRKWAEKIPGFiELSPGDQDLLLE 106
2QW4_A       36 PANLLTSLVRAHLDSGPSTAKLDYSKFQElvlphfgKEDAGDVQQFYDLLSGSLEVIRKWAEKIPGFaELSPADQDLLLE 115
gi 82201020 337 PVNIIASLVTAHIDSNPASANLDYSKYQEstsglpeKEDANDIQQFYDLLTGSMDVIRKWAGSIPGFsAFCKEDQELLLE 416
gi 548354   340 PVDLINSLVRAHIDSIPSSSKLDYSKFQEtvplqleKESSVDVQQFYDLLSGSLEVIRKWAEKIQGFvDLPKEDQDLLLE 419
gi 47222872 352 SVNIVASLVRAHLDSNPTNEKLNYSKYQEsagdlkeKEDASDIQQFYDLLTGSLEVIRNWAETIPGFtDFCKDDQELLLE 431
gi 47229201 250 AVSMMASLVRAHIDSNPSMLDYSKYVETEvrs--hqKEEASDIKQFYDLLAASMEAIREWAKNVPGFsDFCSEDQELLLE 327
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                       
1YJE_A      107 SAFLELFILRLAYRSKPGEGKLIFCSGLVLHRLQCARGFGDWIDNILAFSRSLHSLGVDVPAFACLSALVLITDRHGLQD 186
2QW4_A      116 SAFLELFILRLAYRSKPGEGKLIFCSGLVLHRLQCARGFGDWIDSILAFSRSLHSLLVDVPAFACLSALVLITDRHGLQE 195
gi 82201020 417 SAFVELFILRLAYRSNPETDKLIFCNGVVLHRTQCVRSFGDWIDSIMEFSQSLHRLNLDISAFSCLATLVIITDRHGLKE 496
gi 548354   420 SAFLELFILRLAYRSRPEEGKLIFCNGVVLHRTQCVRGFGEWIDSIIEFSHSLQRMNIDVPSFSCLSALVIVTDRHGLKE 499
gi 47222872 432 SAFVELFILRLAYRSNPEKNKLVFCNGVVLHRLQCIHSFGDWINSIMDFSQSLHRMNLDVSLFACLAALVIITDRHGLKE 511
gi 47229201 328 SAFVELFILRLAYRSDPETEKLVFCKGTVLHKTQCVRGFGDWIDSILEFSQALRRMKLDVSSFSCLAALVIITDRHGLKE 407
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                           #  #   #    
1YJE_A      187 PRRVEELQNRIASCLKEHMaavagd--pqpascLSRLLGKLPELRTLCTQGLQRIFCLKLEDLVPPPPIVDKIFMDTLSF 264
2QW4_A      196 PRRVEELQNRIASCLKEHVaavage--pqpascLSRLLGKLPELRTLCTQGLQRIFYLKLEDLVPPPPIIDKIFMDTLPF 273
gi 82201020 497 PKRIEDFQNRLITCLRDHVstsale--vgrpnsLSRLLSKLPELRTLCTQGLQRIFYLKLEDLVPPPPIVDKIFMDTLPF 574
gi 548354   500 PKKVEELQSQIINCLKEHIpssmne--qnrpncLSKLLGKLPELRTLCTQGLQRIFYLKLEDLVPPPPIVDKIFMDTLPF 577
gi 47222872 512 PKRVEEFQNHLISCLWEHVsgsgsevcrtqssyLSRLLGKLPELRTLCTQGLQRIFYLKLEDLVPPPPIVEKIFLDTLPF 591
gi 47229201 408 PGRVENMQNQLVTCLKDHVsgcase--ssrpnyLSRLLGKLPELRTLCTQGLQRIFYLKLEDLVPPPPIVDKIFMDTLPF 485

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap