Conserved Protein Domain Family
CRD_SFRP1

?
cd07443: CRD_SFRP1 
Cysteine-rich domain of the secreted frizzled-related protein 1 (SFRP1), a regulator of Wnt activity.
The cysteine-rich domain (CRD) is an essential part of the secreted frizzled-related protein 1 (SFRP1), which regulates the activity of Wnt proteins, key players in a number of fundamental cellular processes such as embryogenesis and postnatal development. SFRPs antagonize the activation of Wnt signaling by binding to the CRDs domains of frizzled (Fz) proteins, thereby preventing Wnt proteins from binding to these receptors. SFRPs are also known to have functions unrelated to Wnt, as enhancers of procollagen cleavage by the TLD proteinases. SFRPs and Fz proteins both contain CRD domains, but SFRPs lack the seven-pass transmembrane domain which is an integral part of Fzs. SFRP1 is expressed in many tissues and is involved in the regulation of Wnt signaling in osteoblasts, leading to enhanced trabecular bone formation in adults; it has also been shown to control the growth of retinal ganglion cell axons and the elongation of the antero-posterior axis.
Statistics
?
PSSM-Id: 143552
View PSSM: cd07443
Aligned: 5 rows
Threshold Bit Score: 250.201
Threshold Setting Gi: 76779937
Created: 23-Jan-2009
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
 
putative Wnt
Feature 1:putative Wnt binding site [polypeptide binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                       # ### ###                                                        
gi 61216762   46 YTKPPQCVDIPADLRLCHNVGYKRMVLPNLLEHETMAEVKQQASSWVPLLNKNCHIGTQVFLCSLFAPVCLDRPIYPCRW 125
gi 61216839   52 YTKPHQCVAIPADLRLCHSVGYDKMVLPNLLDHETMAEVKHQASSWVPLLNKNCHMGTQVFLCSLFAPVCLDRPVYPCRW 131
gi 61216811   52 YTKPPQCVDIPADLRLCHNVGYKKMVLPNLLEHETMAEVKQQASSWVPLLNKNCHAGTQVFLCSLFAPVCLDRPIYPCRW 131
gi 158254312  36 SDKHPPCVDIPEDLRLCFNVGYGRMMLPNLLDHETIAEVKQQAVSWVPLVHKACHKGTQVLLCSLFAPVCLDRPLYPCRW 115
gi 76779937   48 YSRPAQCLEIPQDMTLCHGVGYNKMVLPNLLDHETMAEVKYQASSWVPLLSKKCHPSTQVFLCSLFAPVCLDRPVYPCRR 127
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|....*
Feature 1                                                     
gi 61216762  126 LCEAVRDSCEPVMQFFGFYWPEMLKCDKFPEGDV-CIAMTPPNAT 169
gi 61216839  132 LCEAVRDSCEPVMQFFGFFWPEMLKCDQFPQDYV-CIAMTTPNAT 175
gi 61216811  132 LCEAVRDSCEPVMQFFGFYWPEMLKCDKFPEGDV-CIAMTPPNAT 175
gi 158254312 116 FCEAVRDSCAPIMQAFGFPWPEMLRCDKFPLGEV-CISSNATKSN 159
gi 76779937  128 LCESVRDACEPVMQYFGFHWPEMLRCEQYPTEEDvCIAVHLPNAT 172

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap