Conserved Protein Domain Family
CRD_SFRP5

?
cd07444: CRD_SFRP5 
Cysteine-rich domain of the secreted frizzled-related protein 5 (SFRP5), a regulator of Wnt activity.
The cysteine-rich domain (CRD) is an essential part of the secreted frizzled-related Protein 5 (SFRP5), which regulates the activity of Wnt proteins, key players in a number of fundamental cellular processes such as embryogenesis and postnatal development. SFRPs antagonize the activation of Wnt signaling by binding to the CRD domains of frizzled (Fz) proteins, thereby preventing Wnt proteins from binding to these receptors. SFRPs are also known to have functions unrelated to Wnt, as enhancers of procollagen cleavage by the TLD proteinases. SFRPs and Fz proteins both contain CRD domains, but SFRPs lack the seven-pass transmembrane domain which is an integral part of Fzs.
Statistics
?
PSSM-Id: 143553
View PSSM: cd07444
Aligned: 5 rows
Threshold Bit Score: 266.812
Threshold Setting Gi: 61216860
Created: 23-Jan-2009
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
 
putative Wnt
Feature 1:putative Wnt binding site [polypeptide binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                       # ### ###                                                        
gi 61216860   44 YSKPPQCLDIPADLPLCHTVGYKRMRLPNLLEHESLAEVKQQASSWLPLLAKRCHSDTQVFLCSLFAPVCLDRPIYPCRS 123
gi 150421670  47 YSKPPQCLDIPADLPLCHTVGYKRMRLPNLLEHESLAEVKQQASSWLPLLAKRCHSDTQVFLCSLFAPVCLDRPIYPCRS 126
gi 50749675   44 YGREPQCVDIPADMQLCHDVGYKRMRLPNLLEHESMAEAKQQASSWVPLLAKQCHADTQLFLCSLFAPVCLDRPIYPCRS 123
gi 148227730  43 YTKQSQCIDIPSDLHLCHNVGYKKMRLPNLLDHETMPEVKQQASSWVPLLAKRCHRDTQLFLCSLFAPICLERPIYPCRS 122
gi 61097889   46 YAKQPQCVDIPADLRLCYNVGYKKMRLPNLLDHETMPEVKQQAGSWVPLLAKRCHADTQVFLCSLFAPVCLDRPIYPCRS 125
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|....*..
Feature 1                                                       
gi 61216860  124 LCEAARAGCAPLMEAYGFPWPEMLHCHKFPLDNDLCIAVQFGHLPAT 170
gi 150421670 127 LCEAVRAGCAPLMEAYGFPWPEMLHCHKFPLDNDLCIAVQFGHLPAT 173
gi 50749675  124 LCEVVRDACAPVMESYGFPWPEMLHCGKFPSDHDLCIAVQFGNNQAT 170
gi 148227730 123 LCEVVRDSCAPVMESYGFPWPEMLNCNKFPLDNDLCITVQFGSKQVT 169
gi 61097889  126 LCEAVRDSCAPVMETYGFPWPEMLQCEKFPIDNDLCIPMQFSAGHAT 172

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap