Conserved Protein Domain Family
CRD_SFRP2

?
cd07446: CRD_SFRP2 
Cysteine-rich domain of the secreted frizzled-related protein 2 (SFRP2), a regulator of Wnt activity.
The cysteine-rich-domain (CRD) is an essential part of the secreted frizzled related protein 2 (SFRP2), which regulates the activity of Wnt proteins, key players in a number of fundamental cellular processes such as embryogenesis and postnatal development. SFRPs antagonize the activation of Wnt signaling by binding to CRD domains of frizzled (Fz) proteins, thereby preventing Wnt proteins from binding to these receptors. SFRPs and Fz proteins both contain CRD domains, but SFRPs lack the seven-pass transmembrane domain which is an integral part of Fzs. As a Wnt antagonist, SFRP2 regulates Nkx2.2 expression in the ventral spinal cord and anteroposterior axis elongation. SFRP2 also has a Wnt-independent function as an enhancer of procollagen cleavage by the TLD proteinases. SFRP2 binds both procollagen and TLD, thus facilitating the enzymatic reaction by bringing together the proteinase and its substrate.
Statistics
?
PSSM-Id: 143555
View PSSM: cd07446
Aligned: 4 rows
Threshold Bit Score: 252.908
Threshold Setting Gi: 157426933
Created: 23-Jan-2009
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
 
putative Wnt
Feature 1:putative Wnt binding site [polypeptide binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                     # ### ###                                                          
gi 61216846   33 KRSNCKPIPAPMLLCRGIEYQSMRLPNLLGHEtVQEVLEQATTWIPLVQKQCHPDTRKFLCSLFAPVCIDDLDEiiQPCH 112
gi 61216828   36 KRSNCKPIPANLQLCHGIEYQNMRLPNLLGHEtMKEVLEQAGAWIPLVMKQCHPDTKKFLCSLFAPVCLDDLDEtiQPCH 115
gi 239915989  34 KKSNCKPIPTNLLLCHDIEYTNMRLPNLLGHEtMNEVLQQASSWTPLVQKQCHPDTKKFLCSLFAPVCLDDLDEpiQPCR 113
gi 157426933  30 RKSSCKSIPGTMTLCHGVGYTEMRLPNLLGHDtMKEALQQAGSWVPLLSKQCHADTKKFLCSLFAPVCLSELDQavYPCR 109
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|....*...
Feature 1                                                        
gi 61216846  113 SLCEEVKESCAPVMSAFGFPWPDMLDCSRFPKDNDLCIPLASSDHILP 160
gi 61216828  116 SLCVQVKDRCAPVMSAFGFPWPDMLECDRFPQDNDLCIPLASSDHLLP 163
gi 239915989 114 SLCESVKSGCAPVMAAFGFPWPDMLDCRRFPLDNDLCIPPAGADALVP 161
gi 157426933 110 SLCEAVRDGCTPVMSAFGFPWPDMFNCTQFPLGNELCVPPAGSEDKQQ 157

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap