Conserved Protein Domain Family
CRD_Carboxypeptidase_Z

?
cd07447: CRD_Carboxypeptidase_Z 
Cysteine-rich domain of carboxypeptidase Z, a member of the carboxypeptidase E family.
The cysteine-rich-domain (CRD) is an essential part of carboxypeptidase Z, a member of the carboxypeptidase E family of metallocarboxypeptidases. This is a group of Zn-dependent enzymes implicated in the intra- and extracellular processing of proteins. Carboxypeptidase Z removes C-terminal basic amino acid residues from its substrates, particularly arginine. The CRD acts as a ligand-binding domain for Wnts involved in developmental processes. CPZ binds and may process Wnt-4, CPZ has also been found to enhance the induction of the homeobox gene Cdx1. During vertebrate embryogenesis, the CRD of CPZ upregulates Pax3, a Wnt reporter gene essential for patterning of somites and limb development.
Statistics
?
PSSM-Id: 143556
View PSSM: cd07447
Aligned: 5 rows
Threshold Bit Score: 257.375
Threshold Setting Gi: 47214059
Created: 23-Jan-2009
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
 
putative Wnt
Feature 1:putative Wnt binding site [polypeptide binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                  # ### ###                                                             
gi 74762287   40 SATCVDLQLRTCSDAAYNHTTFPNLLQHRSwEVVEASSEYILLSVLHQLLEGQCNPDLRLLGCAVLAPRCEGGWVRRPCR 119
gi 82135378   37 KAKCVDISLSSCTDVTYTQTMYPNFLDQKSrEVIEYSSEYILISVLHNLLQGECNPDLRLLGCSVLAPQCEKDKVIKPCR 116
gi 125804329  79 GPQCIEMVLGYCQDVPYTHTTFPNIVGHRTrQDLEMGAEYLLLSVIHGLMKGECSPDIRILGCSVLAPRCENGRLMKPCR 158
gi 47220249   42 KPTCTELNLGYCNDLDYSWTIFPNILGHRTrTDTESGPEYLLLSVIHGLLNGECSPEIRLLGCSVIASPCRNNKMIKPCR 121
gi 47214059    1 SARCTDVLLSYCSDMSYTQTLFPNLAGHRSrEETEAGAEYLLLSVAEALLGGRCNPEIRMLGCSVLVPRCQRDAVLRPCR 80
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|....*...
Feature 1                                                        
gi 74762287  120 HICEGLREVCQPAFDAIDMAWPYFLDCHRYFTREDEGCYDPLEKLRGG 167
gi 82135378  117 HVCENLKKNCLSAFDAIDMAWPYFLDCDRFFAGEEEGCFDPLAKLRGE 164
gi 125804329 159 SSCEMLKKSCIHAFEAIQMAWPYFLDCDRFFVGSEEGCYDPLSELREK 206
gi 47220249  122 STCDALRKDCAHAFEAIEMAWPYFLDCDRFFASEQEGCFDPLRGLRAR 169
gi 47214059   81 STCQAVRARCSGAFRAIQMNWPYFLDCDRFFGAEQEGCYDPLEGLHDD 128

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap