Conserved Protein Domain Family
CRD_FZ4

?
cd07448: CRD_FZ4 
Cysteine-rich Wnt-binding domain of the frizzled 4 (Fz4) receptor.
The cysteine-rich domain (CRD) is an essential extracellular portion of the frizzled 4 (Fz4) receptor, and is required for binding Wnt proteins, which play fundamental roles in many aspects of early development, such as cell and tissue polarity, neural synapse formation, and the regulation of proliferation. Fz proteins serve as Wnt receptors for multiple signal transduction pathways, including both beta-catenin dependent and -independent cellular signaling, as well as the planar cell polarity pathway and the Ca(2+) modulating signaling pathway. CRD containing Fzs have been found in diverse species from amoebas to mammals. 10 different frizzled proteins are found in vertebrata. Frizzled 4 (Fz4) activates the Ca(2+)/calmodulin-dependent protein kinase II and protein kinase C of the Wnt/Ca(2+) signaling pathway during retinal angiogenesis. Mutations in Fz4 lead to familial exudative vitreoretinopathy (FEVR), a hereditary ocular disorder characterized by failure of the peripheral retinal vascularization. In addition, the interplay between Fz4 and norrin as a receptor-ligand pair plays an important role in vascular development in the retina and inner ear in a Wnt-independent manner.
Statistics
?
PSSM-Id: 143557
View PSSM: cd07448
Aligned: 11 rows
Threshold Bit Score: 243.138
Threshold Setting Gi: 74962066
Created: 23-Jan-2009
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
 
putative Wnt
Feature 1:putative Wnt binding site [polypeptide binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                  # ### ###                                                             
gi 62298045   42 ERRCDPIRisMCQNLGYNVTKMPNLVGHELQTDAELQLTTFTPLIQYGCSS-QLQFFLCSVYVPMCTEKIni-pIGPCGG 119
gi 17433072   28 ERSCDPIRitMCQNLGYNVTKMPNLVGHELQADAELQLTTFTPLIQYGCSS-QLQFFLCSVYVPMCTEKIni-pIGPCGG 105
gi 17433062   30 ERRCDAIRiaMCQNLGYNVTKMPNLVGHELQADAELQLTTFTPLIQYGCSS-QLQFFLCSVYVPMCTEKIni-pIGPCGG 107
gi 20454904   43 FRQCETIRieMCRKIGYNETSMPNLVGNEMQTDVEYTLQTFAPLIEYDCSS-QLKLFLCAAYVPMCTPKApvhaIGPCRS 121
gi 74962066   23 GQRCQKVDheMCNDLPYNLTSFPNLVDEESWKDASESILTYKPLLSVVCSE-QLKFFLCSVYFPMCNEKLan-pIGPCRP 100
gi 47211439   31 EMTCDPIRisMCQGLGYNVTKMPNLVGNVLQSDAELQLTTFTPLIQYGCSS-QLKFFLCSVYVPMCTDKVpi-pIGPCGS 108
gi 215491258  38 GRMCEPIRieMCKDIGYNVTGMPNLVGHELQQDAQLQLQTFKPLVQYGCAS-QLKFFLCSVYVPMCTEKVaq-pIGPCRP 115
gi 219480919  33 QYSCDPIRidMCNNLGYNVTRMPNLVGHDMQQDAELQLQTFTPLIQYGCSS-QLQFFLCSVYVPMCTEKVpi-pIGPCQS 110
gi 118343802  53 DNRCEPIQikMCQGLGYNATRMPNRFGQYRQTEAGIELNSYQVLLQYNCSS-ELPMFLCAAFLPMCEPGLer-tIGPCEG 130
gi 115783460  30 TVMCEPITikLCQGVGYNMTRMPNLVGHELQQDAELQLQTFTPLIQYGCSP-FLRFFLCSVYAPYCTDKIdv-pISVCRP 107
gi 156353207   1 DWKCEKISidLCRSVGYNVTRMPNLIGHETQKEAESQLKQFLPLIQYGCAReQLVFFLCSAYAPMCTDKVdv-vITSCRP 79
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|....*...
Feature 1                                                        
gi 62298045  120 MCLSVKRRCEPVLKEFGFAWPESLNCSKFPPQNDHNHMCMEGPGDEEV 167
gi 17433072  106 MCLSVKRRCEPVLKEFGFAWPESLNCSKFPPQNDHNHMCMEGPGDDEV 153
gi 17433062  108 MCLSVKRRCEPVLKEFGFAWPDSLNCSKFPPQNDHNHMCMEGPGDEEV 155
gi 20454904  122 LCESVRIRCHPVLQGFGFPWPPALDCDKFPRENNHETMCMEGPGELHQ 169
gi 74962066  101 LCLSVQEKCLPVLESFGFKWPDVIRCDKFPLENNREKMCMKGPNEQGA 148
gi 47211439  109 MCISVKKRCFPVLQEFGFIWPEELNCSLFPPQNDHNHMCMEGPGDEDL 156
gi 215491258 116 LCESVRTRCQPVLQEFGFPWPAALNCSKFPPQNNHRHMCMDGPAPEES 163
gi 219480919 111 MCLSVKRRCEPVLKEFGFPWPPTLNCSKFPLQNDHNTMCMEGPGDDEV 158
gi 118343802 131 MCLSIKKLCLPALKSFGYPWPEILNCSNFPKDNKQNMMCMTGTHPHVK 178
gi 115783460 108 LCERVRASCNPVLSKFGFKWAEALNCSQFLERSDGNDICMGPPPGEGD 155
gi 156353207  80 LCEYVRKSCLPVLTEFGIPWPNPLNCTRFLVRNNERNMCMPGPNFTES 127

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap