Conserved Protein Domain Family
CRD_FZ3

?
cd07449: CRD_FZ3 
Cysteine-rich Wnt-binding domain (CRD) of the frizzled 3 (Fz3) receptor.
The cysteine-rich domain (CRD) is an essential extracellular portion of the frizzled 3 (Fz3) receptor, and is required for binding Wnt proteins, which play fundamental roles in many aspects of early development, such as cell and tissue polarity, neural synapse formation, and the regulation of proliferation. Fz proteins serve as Wnt receptors for multiple signal transduction pathways, including both beta-catenin dependent and -independent cellular signaling, as well as the planar cell polarity pathway and Ca(2+) modulating signaling pathway. CRD containing Fzs have been found in diverse species from amoebas to mammals. 10 different frizzled proteins are found in vertebrata. Fz3 plays a vital role in the anterior-posterior guidance of commissural axons. Knockout mice without Fz3 show defects in fiber tracts in the rostral CNS.
Statistics
?
PSSM-Id: 143558
View PSSM: cd07449
Aligned: 5 rows
Threshold Bit Score: 293.068
Threshold Setting Gi: 112363134
Created: 23-Jan-2009
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
 
putative Wnt
Feature 1:putative Wnt binding site [polypeptide binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                   # ### ###                                                            
gi 17433071   24 SLFSCEPITLRMCQDLPYNTTFMPNLLNHYDQQTAALAMEPFHPMVNLDCSRDFRPFLCALYAPICMEYGRVTLPCRRLC 103
gi 17433025   24 SLFSCEPITLRMCQDLPYNTTFMPNLLNHYDQQTAALAMEPFHPMVNLDCSRDFRPFLCALYAPICMEYGRVTLPCRRLC 103
gi 17432977   23 SLFACEPITLRMCQDLPYNSTFMPNLLNHYDQQTAALAMEPFHPMVNLECSRDLRPFLCALYTPVCMEYGRMTLPCRKLC 102
gi 118089114  24 SLFSCEPIILRMCQDLPYNTTFMPNLLNHYDQQTAALAMEPFHPMVNLECSRDFRPFLCALYAPVCMEYGRVTLPCRRLC 103
gi 112363134  26 SMFSCEPITLRMCQGLAYNTTFMPNLLNHYDQQTAALAMEPFHPMVNLECSTEIRPFLCALYAPVCTEYGRVTLPCRRLC 105
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|....*..
Feature 1                                                       
gi 17433071  104 QRAYSECSKLMEMFGVpWPEDMECSRFPDCDEPYPRLVDLNLAGEPT 150
gi 17433025  104 QRAYSECSKLMEMFGVpWPEDMECSRFPDCDEPYPRLVDLNLVGDPT 150
gi 17432977  103 QRAYNECFKLMEMFGVpWPEEMECSRFPDCDEPYPRIVDISLSGEPS 149
gi 118089114 104 QRAYSECSKLMEMFGVsWPEDMECTRFPDCDEPYPRLVDLSLGGEPT 150
gi 112363134 106 QRAKSDCYKLMEMFGVsWPDEMECSRFPECEESYPRAIDLLPSSDST 152

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap