Conserved Protein Domain Family
CRD_LIN_17

?
cd07454: CRD_LIN_17 
Cysteine-rich domain (CRD) of LIN_17
A cysteine-rich domain (CRD) is an essential component of a number of cell surface receptors, which are involved in multiple signal transduction pathways, particularly in modulating the activity of the Wnt proteins, which play a fundamental role in the early development of metazoans. CRD is also found in secreted frizzled related proteins (SFRPs), which lack the transmembrane segment found in the frizzled protein. The CRD domain is also present in the alpha-1 chain of mouse type XVIII collagen, in carboxypeptidase Z, several receptor tyrosine kinases, and the mosaic transmembrane serine protease corin. The CRD domain is well conserved in metazoans - 10 frizzled proteins have been identified in mammals, 4 in Drosophila and 3 in Caenorhabditis elegans. CRD domains have also been identified in multiple tandem copies in a Dictyostelium discoideum protein. Very little is known about the mechanism by which CRD domains interact with their ligands. The domain contains 10 conserved cysteines. The protein lin-17 is involved in cell type specification during Caenorhabditis elegans vulval development.
Statistics
?
PSSM-Id: 143563
View PSSM: cd07454
Aligned: 3 rows
Threshold Bit Score: 169.962
Threshold Setting Gi: 75018841
Created: 29-Jan-2009
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
 
putative Wnt
Feature 1:putative Wnt binding site [polypeptide binding site]
Evidence:
  • Comment:Inferred by similarity to other members of the CRD_FZ superfamily.
  • Comment:Wnt binding surface annotation based on mutation analysis of CRD domain

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                  # ##  ###                                                            
gi 75018841  24 VKGKCIPIDIELCKDLPYNYTYFPNTIlhndQHTLQTHTEHFKPLMKTKCHPHIHFFICSVFAPMCPIGMPQAVTSCKSV 103
gi 49781255  26 TKGRCVPMQHKMCADIPYNMTYHPNPI----SATEQSQIDHFNPLIKTKCHPHIKFFVCSVFEPMCPDQMPQAVTACRSV 101
gi 71996209  24 VKGKCIPIDIELCKDLPYNYTYFPNTIlhndQHTLQTHTEHFKPLMKTKCHPHIHFFICSVFAPMCPIGMPQAVTSCKSV 103
                        90       100       110       120
                ....*....|....*....|....*....|....*....|....
Feature 1                                                   
gi 75018841 104 CEQVKADCFSILEEFGIGWPEPLNCAQFPDPPELCMKPTEDEIT 147
gi 49781255 102 CEEVKRECVSIIEEFGLQWPELLECSKFPAQPDLCMQPMDNVGQ 145
gi 71996209 104 CEQVKADCFSILEEFGIGWPEPLNCAQFPDPPELCMKPTEDEIT 147

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap