1IJY


Conserved Protein Domain Family
CRD_FZ8

?
cd07461: CRD_FZ8 
Click on image for an interactive view with Cn3D
Cysteine-rich Wnt-binding domain (CRD) of the frizzled 8 (Fz8) receptor.
The cysteine-rich domain (CRD) is an essential extracellular portion of the frizzled 8 (Fz8) receptor, and is required for binding Wnt proteins, which play fundamental roles in many aspects of early development, such as cell and tissue polarity, neural synapse formation, and the regulation of proliferation. Fz proteins serve as Wnt receptors for multiple signal transduction pathways, including both beta-catenin dependent and -independent cellular signaling, as well as the planar cell polarity pathway and Ca(2+) modulating signaling pathway. CRD containing Fzs have been found in diverse species from amoebas to mammals. 10 different frizzled proteins are found in vertebrata. Xenopus Fz8 is important in Wnt/beta-catenin signaling pathways controlling the transcriptional activation of target genes Siamois and Xnr3 in the animal caps of late blastula.
Statistics
?
PSSM-Id: 143570
View PSSM: cd07461
Aligned: 4 rows
Threshold Bit Score: 279.174
Threshold Setting Gi: 15826376
Created: 23-Jan-2009
Updated: 17-Jan-2013
Structure
?
Program:
Drawing:
Aligned Rows:
 
putative Wnt
Conserved site includes 7 residues -Click on image for an interactive view with Cn3D
Feature 1:putative Wnt binding site [polypeptide binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                  # ### ###                                                            
1IJY_A        6 KELACQEITVPLCKGIGYEYTYMPNQFNHDTQDEAGLEVHQFWPLVEIQCSPDLKFFLCSMYTPICLEDYKKPLPPCRSV 85
gi 17432990  24 KELSCQEITVPLCKDIGYNYTYMPNQFNHDTQDEAGMEVHQFWPLVVIHCSPDLKFFLCSMYTPICLEDYKKPLPPCRSV 103
gi 6649950   26 KEITCQEIAVPLCKGIGYNYTYMPNQFNHDTQDEAGLEVHQFWPLVEIQCSPDLKFFLCSMYTPICLEDYKKPLPPCRSV 105
gi 47228135  25 KERQCQEITVPLCKGIGYNHTYMPNQFNHDTQDEAGLEVHQFWPLVEIKCSPDLRFLLCSMYTPICLEDYKKPLPPCRSV 104
                        90       100       110       120
                ....*....|....*....|....*....|....*....|....*
Feature 1                                                    
1IJY_A       86 CERAKAGCAPLMRQYGFAWPDRMRCDRLPEQGNPDTLCMDYERTD 130
gi 17432990 104 CERARAGCAPLMRQYGFAWPDRMRCDRLPEQGNPDTLCMDYYNRT 148
gi 6649950  106 CERAKAGCAPLMRQYGFPWPDRMRCDLLPVQGAPDTLCMDYNRTD 150
gi 47228135 105 CERAKAGCAPLMRQYGFPWPDRMRCELLPEQGNKDTLCMDYNRSQ 149

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap