Conserved Protein Domain Family
CRD_FZ10

?
cd07462: CRD_FZ10 
Cysteine-rich Wnt-binding domain (CRD) of the frizzled 10 (Fz10) receptor.
The cysteine-rich domain (CRD) is an essential extracellular portion of the frizzled 10 (Fz10) receptor, and is required for binding Wnt proteins, which play fundamental roles in many aspects of early development, such as cell and tissue polarity, neural synapse formation, and the regulation of proliferation. Fz proteins serve as Wnt receptors for multiple signal transduction pathways, including both beta-catenin dependent and -independent cellular signaling, as well as the planar cell polarity pathway and Ca(2+) modulating signaling pathway. CRD containing Fzs have been found in diverse species from amoebas to mammals. 10 different frizzled proteins are found in vertebrata. The cellular functon of Fz10 is unknown.
Statistics
?
PSSM-Id: 143571
View PSSM: cd07462
Aligned: 4 rows
Threshold Bit Score: 294.619
Threshold Setting Gi: 16508271
Created: 23-Jan-2009
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
 
putative Wnt
Feature 1:putative Wnt binding site [polypeptide binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                  # ### ###                                                            
gi 17433091  30 GDGKCQPIEIPMCKDIGYNMTRMPNLMGHENQREAAIQLHEFAPLVEYGCHGHLRFFLCSLYAPMCTEQVSTPIPACRVM 109
gi 17433096  30 GEGRCQAIEIPMCKDIGYNMTRMPNLMGHENQKEAAIQLHEFAPLVEYGCHSHLKFFLCSLYAPMCTEQVSTPIPACRVM 109
gi 17433077  34 GDGRCQPIEIPMCKDIGYNMTRMPNLMGHENQREAAIQLHEFAPLVEYGCHGHLKFFLCSLYAPMCTEQVSTPIPACRVM 113
gi 16508271  31 GEGRCQEIAIPLCKDIGYNLTVMPNLMGHEDQNEAAIKLHEFAPLIEFGCHSHLKFFLCSLYAPMCTEQVSTPIPACRVM 110
                        90       100       110       120
                ....*....|....*....|....*....|....*....|....*..
Feature 1                                                      
gi 17433091 110 CEQARLKCSPIMEQFNFKWPDSLDCRKLPNKNDPNYLCMEAPNNGSD 156
gi 17433096 110 CEQARLKCSPIMEQFNFKWPDSLDCSKLPNKNDPNYLCMEAPNNGTD 156
gi 17433077 114 CEQARLKCSPIMEQFNFKWPDSLDCSKLPNKNDPNYLCMEAPNNGSD 160
gi 16508271 111 CEQARQKCSPIMEQFNFHWPESLDCSRLPNKNDPNYLCMEAPNNGTD 157

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap