Conserved Protein Domain Family
CRD_FZ2

?
cd07464: CRD_FZ2 
Cysteine-rich Wnt-binding domain (CRD) of the frizzled 2 (Fz2) receptor.
The cysteine-rich domain (CRD) is an essential extracellular portion of the frizzled 2 (Fz2) receptor, and is required for binding Wnt proteins, which play fundamental roles in many aspects of early development, such as cell and tissue polarity, neural synapse formation, and the regulation of proliferation. Fz proteins serve as Wnt receptors for multiple signal transduction pathways, including both beta-catenin dependent and -independent cellular signaling, as well as the planar cell polarity pathway and Ca(2+) modulating signaling pathway. CRD containing Fzs have been found in diverse species from amoebas to mammals. 10 different frizzled proteins are found in vertebrata. Fz2 is involved in the Wnt/beta-catenin signaling pathway and in the activation of protein kinase C and calcium/calmodulin-dependent protein kinase (CaM kinase).
Statistics
?
PSSM-Id: 143573
View PSSM: cd07464
Aligned: 3 rows
Threshold Bit Score: 275.812
Threshold Setting Gi: 17433063
Created: 23-Jan-2009
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
 
putative Wnt
Feature 1:putative Wnt binding site [polypeptide binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                  # ### ###                                                            
gi 17432927  40 DHGFCQPISIPLCTDIAYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVCTVLEQAIPPCRSIC 119
gi 17433063   2 DHGFCQPISIPLCTDIAYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSLELKFFLCSMYAPVCTVLEQAIPPCRSIC 81
gi 17433076  34 EHGFCQPISIPLCTDIAYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSSELRFFLCSMYAPVCTVLEQAIPPCRSIC 113
                        90       100       110       120
                ....*....|....*....|....*....|....*....|....*..
Feature 1                                                      
gi 17432927 120 EraRQGCEALMNKFGFQWPERLRCEHFPRHGAEQICVGQNHSEDGTP 166
gi 17433063  82 EraRQGCEALMNKFGFQWPERLRCENFPRHGAEQICVGQNHSEDGGS 128
gi 17433076 114 EraRHGCEALMNKFGFQWPERLRCENFPRHGAEQICVGQNHSEDGGP 160

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap