Conserved Protein Domain Family
CRD_FZ7

?
cd07466: CRD_FZ7 
Cysteine-rich Wnt-binding domain (CRD) of the frizzled 7 (Fz7) receptor.
The cysteine-rich domain (CRD) is an essential extracellular portion of the frizzled 7 (Fz7) receptor, and is required for binding Wnt proteins, which play fundamental roles in many aspects of early development, such as cell and tissue polarity, neural synapse formation, and the regulation of proliferation. Fz proteins serve as Wnt receptors for multiple signal transduction pathways, including both beta-catenin dependent and -independent cellular signaling, as well as the planar cell polarity pathway and Ca(2+) modulating signaling pathway. CRD containing Fzs have been found in diverse species from amoebas to mammals. 10 different frizzled proteins are found in vertebrata. Xenopus Fz7 is important in Wnt/beta-catenin signaling pathways controlling the transcriptional activation of target genes Siamois and Xnr3 in the animal caps of late blastula.
Statistics
?
PSSM-Id: 143575
View PSSM: cd07466
Aligned: 4 rows
Threshold Bit Score: 270.419
Threshold Setting Gi: 68085067
Created: 23-Jan-2009
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
 
putative Wnt
Feature 1:putative Wnt binding site [polypeptide binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                  # ### ###                                                            
gi 82177200  32 DHGFCQPISIPLCTDIAYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVCTVLEQAIPPCRSLC 111
gi 52788226  45 DHGFCQPISIPLCTDIAYNQTILPNLLGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVCTVLDQAIPPCRSLC 124
gi 17432983  43 DHGFCQPISIPLCTDIAYNQTILPNLLGHTNQEDAGLEVHQFYPLVKVQCSAELKFFLCSMYAPVCTVLEQAIPPCRSLC 122
gi 68085067  41 EHGFCQPISIPLCTDIAYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSMDLKFFLCSMYAPVCTVLEQAIPPCRSLC 120
                        90       100       110       120
                ....*....|....*....|....*....|....*....|....*
Feature 1                                                    
gi 82177200 112 ERARQGCEALMNKFGFQWPERLRCENFPVHGAGEICVGQNTSDNS 156
gi 52788226 125 ERARQGCEALMNKFGFQWPERLRCENFPVHGAGEICVGQNTSDGS 169
gi 17432983 123 ERARQGCEALMNKFGFQWPERLRCENFPVHGAGEICVGQNTSDAP 167
gi 68085067 121 ERARQGCEALMNKFGFQWPERLRCENFPVHGAGEICVGQNTSDAG 165

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap