Conserved Protein Domain Family
P-type_ATPase_APLT_Neo1-like

?
cd07541: P-type_ATPase_APLT_Neo1-like 
Aminophospholipid translocases (APLTs), similar to Saccharomyces cerevisiae Neo1p and human putative APLT, ATP9B.
Aminophospholipid translocases (APLTs), also known as type 4 P-type ATPases, act as a flippases, and translocate specific phospholipids from the exoplasmic leaflet to the cytoplasmic leaflet of biological membranes. The yeast Neo1 gene is an essential gene; Neo1p localizes to the endoplasmic reticulum and the Golgi complex and plays a role in membrane trafficking within the endomembrane system. Also included in this sub family is human putative ATPase phospholipid transporting 9B, ATP9B, which localizes to the trans-golgi network in a CDC50 protein-independent manner. Levels of ATP9B, along with levels of other ATPase genes, may contribute to expressivity of and atypical presentations of Hailey-Hailey disease (HHD), and the ATP9B gene has recently been identified as a putative Alzheimer's disease loci. This subfamily belongs to the P-type ATPases, a large family of integral membrane transporters that are of critical importance in all kingdoms of life. They generate and maintain (electro-) chemical gradients across cellular membranes, by translocating cations, heavy metals and lipids, and are distinguished from other main classes of transport ATPases (F- , V- , and ABC- type) by the formation of a phosphorylated (P-) intermediate state in the catalytic cycle.
Statistics
?
PSSM-Id: 319841
View PSSM: cd07541
Aligned: 9 rows
Threshold Bit Score: 1351.69
Threshold Setting Gi: 5101680
Created: 27-Oct-2008
Updated: 18-Aug-2016
Structure
?
Aligned Rows:
 
Feature 1: P-type ATPase signature motif, 7 residue positions
Conserved feature residue pattern:D K [TS] G T [LIVM] [TS]Click to see conserved feature residue pattern help
Evidence:
  • Comment:a characteristic P-type ATPase conserved sequence motif: DK[TS]GT[LIVM][TS], in which D is the reversibly phosphorylated Asp

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                         
gi 215274251  132 RNSIKNQKYNVFTFIPGVLYEQFKFFLNLYFLVISCSQFVPalkiGYLYTYWAPLGFVLAVTMTREAIDEFRRFQRDKEv 211
gi 45361309    55 KNVINNQKYNFFTFLPGILYNQFKYFFNLYFLVLACTQFVPemrlGPLYTFWVPLGFVLLVTIIREAVEEIRCFVRDKEv 134
gi 17559268    95 PNTVRNQKYNIFSFVPVVLFQEFKFFLNLYFLIMAFSQLVPifkiGALVTYWFPLGFILTITLIREAIEDFARFLRDREl 174
gi 50256015   101 ANVVRNQKYSILSFLPLVFYEQFKFFFNFYFLVVALSQFIPalkiGYIVTYVAPLAFVLAVTMGKEAFDDYSRYLRDRE- 179
gi 5101680     38 SNKVENNRYTYLNYIPKCLFNQFKYFYNLYFLITALSQFVPilqvGYRFTYTMPLAFVVILAMAKDAYDDIRIRIRDKQ- 116
gi 731806     172 SNELSNAKYNAVTFVPTLLYEQFKFFYNLYFLVVALSQAVPalriGYLSSYIVPLAFVLTVTMAKEAIDDIQRRRRDRE- 250
gi 20301938   230 PNEIRNQKYNFITFLPLVLFEQFRFFLNLYFLLMALSQFIPdiriGYPYTYWGPLGFVLMVTICREAVDDLRRHQRDHEv 309
gi 1723470     91 NNAVTNTKYDLFTFLPKCLYEQFRYFYNMYFLLVSLSQLIPplkiGYLSTYIAPLIFVLLITLTKEAVDDLKRRRRDSY- 169
gi 385178611  119 KNAIKNQKYNIVTFVPGVLYQQFKFFLNLYFLVVACSQFVPslkiGYLYTYWAPLGFVLAVTMVREAVDEVRRCRRDKEm 198
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                         
gi 215274251  212 nsQLYSKLTVRg----------------------KVQVKSSDIQVGDLIIVEKNQRIPSDMVFLRTSEkaGSCFIRTDQL 269
gi 45361309   135 nsQIYSKLTNRg----------------------TVKVRSSNIQVGDLVIVEKNQRIPADMIFLRTSEknGSCFLRTDQL 192
gi 17559268   175 nsEKYEKLTRDg---------------------tRVEIKSADIKVGDVIVMHKDRRVPADVVLLRTSDksSSCFIRTDQL 233
gi 50256015   180 --ANSTRYLVLvpqppspnpssdgeqtpslprpqTRSTPASSIKVGDMVLLEKNQRVPADMVLLTTSEeeGTCFIRTDQL 257
gi 5101680    117 --TNSQPFTQLig-------------------gePKEIQSKDIVVGNILKLKKDERVPADCLILRSTEesGSIFIRTDQL 175
gi 731806     251 --SNNELYHVIt---------------------rNRSIPSKDLKVGDLIKVHKGDRIPADLVLLQSSEpsGESFIKTDQL 307
gi 20301938   310 nsQKYKRLSSTni-------------------sgYEMVPSSKLKVGDVIIVEKNERVPADLILLRTSDrsGSVFVRTDQL 370
gi 1723470    170 --ANNEIYTVN-----------------------DSPCAAQNIQAGDVVYIAKDQRIPADMILLETTVg-NEAFIRTDQL 223
gi 385178611  199 nsQLYSKLTVRg----------------------KVQVKSSDIQVGDLIIVEKNQRIPADMIFLRTSEktGSCFIRTDQL 256
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                         
gi 215274251  270 DGETDWKLKvavsCTQQLPALGDLFSisayvyaQKPQMDIHSFEGTFTreds----dppIHESLSIENTLW-ASTIVASG 344
gi 45361309   193 DGETDWKLRlpvaCTQRLPTAADLLQirsyiyaEEPNIDIHNFAGTFTreds----dppTNESLSIENTLW-ASTVIASG 267
gi 17559268   234 DGETDWKLKipipFTQHLANESEIMElncevyaEKPQKDIYSFVGTVKitad----dkiHEGSLDVENVLW-ANTVVSSG 308
gi 50256015   258 DGETDWKLKvavgETQKMGEAFVGSAegs-lyaDPPIKDIHTFYGVFTlrstspgeqteTSTPLSVENVLW-ANTVLAAG 335
gi 5101680    176 DGETDWKLRraigETQKMDIQTICNSqfe-lnvEAPHADVYSFQGTIRine------dpKIYSLNVENTAW-ANTIVASD 247
gi 731806     308 DGETDWKLRvacpLTQNLSENDLINRisi--taSAPEKSIHKFLGKVTyk-------dsTSNPLSVDNTLWaNTVLASSG 378
gi 20301938   371 DGETDWKPRlavpYTQKLSRDSELHSidasfyvEKPQNDIHSFIATFCmad------gsEDTGLSVENTLW-ANTVVAAG 443
gi 1723470    224 DGETDWKLRi---PCSNQHTEGIVHA-------DAPIKSVHHFYGTFTln--------nQKRPISVDHTLW-ANTVLASD 284
gi 385178611  257 DGETDWKLRigvaCTQRLPALGDLFSisayvyvQKPQLDIHSFEGNFTredc----dppIHESLSIENTLW-ASTVVASG 331
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                         
gi 215274251  345 TVIGVVIYTGKETRSVMNTSNPKNKVGLLDl-eLNRLTKALFLALVALSIVMVTLQGfvgpw---yrnlfRFLLLFSYII 420
gi 45361309   268 TVVGVVVYTGREQRSVMNTSNPRSKIGLFDl-eLNCLTKILFSALIVVSLVMVALQHfagrw---ylqiiRFLLLFSSII 343
gi 17559268   309 TAIGVVVYTGCETRSVMNTTVPEYKVGLLDl-eINNLTKLLFCFVLLLASVMVLMKGptslw---ylylaRFILLFSYII 384
gi 50256015   336 SAVGLVVYTGKETRAVLNTSEAGTKMGTLEk-eVNKMAKILCTVTFALSVILVALNGfrgqw---yiyvfRFLILFSSII 411
gi 5101680    248 EMCALVIYTGNDTRLARNRKQSGNVKRGKTedeVNFLSKILFCSLMGLSILMIMPDLiqhpnwfilvsltRFMILFSSII 327
gi 731806     379 FCIACVVYTGRDTRQAMNTTTAKVKTGLLEl-eINSISKILCACVFALSILLVAFAGfhnddw--yidilRYLILFSTII 455
gi 20301938   444 TATGIVIYTGCETRSVMNNSQPRSKVGLLDm-eINGLTKVLFCAVLGLSLVMMMLKGfggpw---yrymfRFVLLFSYII 519
gi 1723470    285 GVYGVVVYTGKDTRQSMNSSKAKTKVGLLEk-eINFYSKILCTFVLVLSIGLTFSHGiktdw---yisvfRYLILFSSII 360
gi 385178611  332 TVIGVVIYTGKEMRSVMNTSQSKNKVGLLDl-eLNRLTKALFLAQVVLSVVMVALQGflgpw---frnlfRFVVLFSYII 407
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                        #######                          
gi 215274251  421 PISLRVNLDMGKAVYGWMMMKDenipgtVVRTSTIPEELGRLVYLLTDKTGTLTQNEMIFKRLHLGTVSYGadtmdeiqs 500
gi 45361309   344 PISLRVNLDMGKIVYSWLIRRDpkipgtVVRASTIPEQLGRISYLLTDKTGTLTQNEMVFKRLHLGTVAYGtdsmdevqs 423
gi 17559268   385 PISLRTNVDMAKLFYSWQIGHDhhipetVVRSSTIPEELGRISFLLSDKTGTLTKNEMHFKKIHLGTVAFSgdaleeveq 464
gi 50256015   412 PISLRVNLDMGKTVYAHQIQTDkeipetIVRTSTLPEELGRVEYLLSDKTGTLTRNEMELKKLHMGTLVFGwdsmdevsh 491
gi 5101680    328 PISMRVNLDIAKMVYAFFINRDkdiagaEVRNSTLPEELGRVDFVLSDKTGTLTKNEMTFQVLCMQSETIRstnfddikd 407
gi 731806     456 PVSLRVNLDLAKSVYAHQIEHDktipetIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKIHLGTVSYTsetldivsd 535
gi 20301938   520 PISLRVNLDMGKAFYSWQMQNDsniqgtVVRSTTIPEELGRISYVLTDKTGTLTQNEMVFKKIHLGIVSHDadtfhhigq 599
gi 1723470    361 PINLRVNLDLAKIVHSKNTESDpnlpgvVVRSSNIPEELGRIEYVLTDKTGTLTQNEMEMKKLHVGTMGFSaesmdvvqa 440
gi 385178611  408 PISLRVNLDMGKSAYGWMIMKDenipgtVVRTSTIPEELGRLVYLLTDKTGTLTQNEMVFKRLHLGTVSYGtdtmdeiqs 487
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                         
gi 215274251  501 hvrdsysqmqsqaggnntgstplrkaqssapkvrksvssriheavkaivlchnvt----------------------pvy 558
gi 45361309   424 hifsvytqpaqdppsqkgmstkvrktmssrvyeavkaialchnvtpsy-------------------------------- 471
gi 17559268   465 hvksaydsalvkhpfsaklknaveslalchnvtpvle------------------------------------------- 501
gi 50256015   492 llsqaldetsgphgrqgslpggnqrgrrdmtgrvrdtvmalat------------------------------------- 534
gi 5101680    408 direclqsneekvlfkkkknpkfimrcvqamalchnvt------------------------------------------ 445
gi 731806     536 yvqslvsskndslnnskvalsttrkdmsfrvrdmiltlaic--------------------------------------- 576
gi 20301938   600 miqklsgnilqqqqgslsssssggdstkpmmfgnrmrrpegwreweavralalchnvtpvsddednrsvstastvtggnn 679
gi 1723470    441 ciqnystpiplsedsktlvrnlvlalslchnvt----------------------------------------------- 473
gi 385178611  488 hiiqsyaqvssaqsngssasstpsrkpqppapkvrksvssriheavkaialchnvt--------------------pvye 547
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                         
gi 215274251  559 esragvteetefaeadqdfsdenrtyqasspdevalvqwtesvgltlvsrdltsmqlktpsGQVLSFCILQLFPFTSESK 638
gi 45361309   472 ----esngvtdqaeaerqfedscrvyqasspdevalvqwtesvglslvgrdqssmqlrtpsGQILNFSILQIFPFTYESK 547
gi 17559268   502 ----------------ngelsyqaaspdevalvkwtetvgvklahrdlhtmtldvqpsngtTVPIQFQILHVFPFTSERK 565
gi 50256015   535 ----------chnvtpvvnddgtttyqasspdevaivqwtesvgltltsrdrtsmvvrssaGRSLTFDILSIFPFTSESK 604
gi 5101680    446 ---------------psfnengekyyqasspdevalvkfaesvgvvleertfkkivlnmpmIGNVEYEILNVFPFSSSTK 510
gi 731806     577 -----------hnvtptfeddeltyqaaspdeiaivkftesvglslfkrdrhsisllhehsGKTLNYEILQVFPFNSDSK 645
gi 20301938   680 sptksvinieapgstdtehqyqaaspdeialvkwteqvgltliardlntmtlqvktpsednDILLHYQILQLFPFTSESK 759
gi 1723470    474 --------------------pskghdgvvsyqaaspdevaivkwtstlglvltnrtrdaitLNNNVYKILNIFPFKSETK 533
gi 385178611  548 srvnganaepesteadqdfsddnrtyqasspdevalvrwtesvgltlvnrdltslqlktpaGQILTYYILQIFPFTSESK 627
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                         
gi 215274251  639 RMGVIVRdestaeITFYMKGADVAMSPIVQYNDWLEEECGNMAREGLRTLVVAKKALTEEQYQdfesryt---qaklsmh 715
gi 45361309   548 RMGIIVRedstgeITFYMKGADVVMAGIVQYNDWLEEECGNMAREGLRVLVVAKKSLTEEQYQdfearyv---qaklsvh 624
gi 17559268   566 RMGIIVKeetsgeVTLYIKGADTVMSDMVQYNDWLDEECTNMAREGLRTLVFAKKILSRAELEafdqayh---aakmsit 642
gi 50256015   605 RMGIIIRdretggITFVQKGADVVMSKIVQKNDWLEEETGNMAREGLRTLVLARKKLSEEAYAafdkayra--aqllpse 682
gi 5101680    511 RMGIIVRnnkdneIYLLMKGADNVMSKIIKDNEWLSEECNNLAREGLRTLVFGSRKMSQEEYQafnerydhantlmtgre 590
gi 731806     646 RMGIIVRdeqldeYWFMQKGADTVMSKIVESNDWLEEETGNMAREGLRTLVIGRKKLNKKIYEqfqkeyn---daslsml 722
gi 20301938   760 RMGIIVResktgqITFYLKGADVVMSSIVQYNDWLSEESGNMAREGLRTLVVAKKVLTEEQYSdfetryn---aarlsit 836
gi 1723470    534 RMGIIVQspd-ekITFYLKGADSIMQNFVKPSFWLEEECGNLAREGLRTLVVAKKDLSAEEYSafslahsd--aslsfsn 610
gi 385178611  628 RMGIIVReeatgdITFYMKGADVAMASIVQYNDWLEEECGNMAREGLRTLVVAKKSLTEEQYQdfenryn---qaklsih 704
                         650       660       670       680       690       700       710       720
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                         
gi 215274251  716 DRSLKVAAVve-sLEREMELLCLTGVEDQLQaDVRPTLEMLRNAGIKIWMLTGDKLETATCIAKSSHLVSRTQDihifrq 794
gi 45361309   625 DRSLKVATVie-sLEMEMELLCLTGVEDQLQaDVRPTLEMLRNAGMKVWMLTGDKLETATCTAKNAHLVTRNQDihvfrp 703
gi 17559268   643 NRTQNMANVvknmLERDLQLICLTGVEDRLQdQVTTSLELLRNAGIKIWMLTGDKLETAICIAKSSGLFSKSDHihvfgs 722
gi 50256015   683 SRASSITSVisqhLETELELLALTGVEDKLQeDVKSTLELLRNAGLKIWMLTGDKIETATNIAVSSKLVARGQYihqaak 762
gi 5101680    591 EEVLKVQES----IEHGLNAMCITGVEDELQeDVQKTLEMLKQANVRVWMLTGDKVETATCIAKSTKLVDIDQEiiqffa 666
gi 731806     723 NRDQQMSQVitkyLEHDLELLGLTGVEDKLQkDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKLISRGQYvhtitk 802
gi 20301938   837 DRVAKVAAVte-sLERELELLCLTGVEDRLQeNVRPTLELLRNAGVRVWMLTGDKLETACCIAKSSQLIGRNQGlhvlrs 915
gi 1723470    611 SRDKKMEEIvsryLENDMDLLGLTGVEDKLQkDVKITLELLRNAGIHVWMLTGDKVETARCIAISSRLVSRGQYihtinq 690
gi 385178611  705 DRNLKVAAVve-sLEREMELLCLTGVEDQLQaDVRPTLELLRNAGIKIWMLTGDKLETATCIAKSSHLVSRNQDihvfkp 783
                         730       740       750       760       770       780       790       800
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                         
gi 215274251  795 vtsrgeahleLNAFRRKHDCALVISGDSLEVCLKYYEHeFVELACQCPAVVCCRCSPTQKARIVTLLQqht-grrTCAIG 873
gi 45361309   704 vtnrgeahleLNAFRRKHDCALVISGDSLEVCLKYYEYeFMELACQCPAVVCCRCAPTQKAQIVRLLQert-gklTCAVG 782
gi 17559268   723 vqtrtdayneLDNLRNKTNIALVMPGSSLNICLQYYEEeVAELVCASTAVVCCRCSPEQKAQIVQLLRkyraplrVAAIG 802
gi 50256015   763 lttadqvrdmLDFLHTKLDCALVIDGESLQLSLDRFRSeFIILATQLPIVVACRCSPTQKADVAKLIReyt-kktVCCIG 841
gi 5101680    667 nsideatsliFNNEGSIGTKALIVDGNTLSLMLKEMSKeFIQFALKAQAVVCCRCLPSQKADIVRLVKssg--ltTCAIG 744
gi 731806     803 vtrpegafnqLEYLKINRNACLLIDGESLGMFLKHYEQeFFDVVVHLPTVIACRCTPQQKADVALVIRkmt-gkrVCCIG 881
gi 20301938   916 vktrtdahqeLNSFRRKQGHALVISGESLEVCLQYYRPeFLELATASPAVVCCRCSPTQKAQVVALIQkht-gkrTCAVG 994
gi 1723470    691 lssreeahnhLLTLRNKPDSCLIIDGESMEFCIGYLQNeFIDIVSDLSSVVICRCTPTQKANMTRLIQekk-qasVCCIG 769
gi 385178611  784 vsnrgeahleLNAFRRKHDCALVISGDSLEVCLRYYEHeFVELACQCPAVVCCRCSPTQKAQIVRLLQqht-anrTCAIG 862
                         810       820       830       840       850       860       870       880
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                         
gi 215274251  874 DGGNDVSMIQAADCGIGIEGKEGKQASLAADFSITQFRHIGRLLMVHGRNSYKRSAALGQFVMHRGLIISTMQAVFSSVF 953
gi 45361309   783 DGGNDVSMIQEADCGVGVEGKEGKQASLAADFSVTQFKHLGRLLMVHGRNSYKRSAGLSQFVIHRSLCISTMQAVFSSVF 862
gi 17559268   803 DGGNDVSMIQAAHAGIGIDANEGKQASLAADFSITQFSHICRLLLVHGRFSYKRSCTLAQFIMHRGLLISIVQAIFSCVF 882
gi 50256015   842 DGGNDVSMIQAADVGVGIVGKEGKQASLAADFSINQFSYLTKLLLWHGRNSYKRSAKLSQFVIHRGLIIAVIQAVFSSIF 921
gi 5101680    745 DGGNDVSMIQEADVGLGIEGKEGKQASMAADFSIKQFSHMLKLLLWHGRNSYIRTSDLALFIMHRGMIISIMQAVFSMVF 824
gi 731806     882 DGGNDVSMIQCADVGVGIVGKEGKQASLAADFSITQFCHLTELLLWHGRNSYKRSAKLAQFVMHRGLIIAICQAVYSICS 961
gi 20301938   995 DGGNDVSMIQQADAGVGIEGREGRQASLAGDFSIPQFSHIAKLLLIHGRRSYKRSAALSQFVIHRGLIITTLQAVFSAVF 1074
gi 1723470    770 DGGNDVGMIQVANVGIGIVGKEGQQASLAADYSVKEFSHVSRLLLWHGRISYKQTSKLAMFVIHRGLLISVCQVVYSVIS 849
gi 385178611  863 DGGNDVSMIQAADCGIGIEGKEGKQASLAADFSITQFKHIGRLLMVHGRNSYKRSAALGQFVMHRGMIISTMQAVFSSIF 942
                         890       900       910       920       930       940       950       960
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                         
gi 215274251  954 YFASVPLYQGFLMVGYATIYTMFPVFSLVLDQDVkpEMAMLYPELYKDLTKGRslSFKTFLIWVLISIYQGGILMYGALV 1033
gi 45361309   863 YFASVPLYQGFLIIGYSTIYTMFPVFSLVLDKDVksEVAMLYPELYKDLLKGRplSYKTFLIWVLISIYQGSIIMYGALL 942
gi 17559268   883 YFVAVSLYQGVLMVAFTSCYTLLPVFSLIADRDVtaTNALTYPELYKELVKGRtlSYKTFFIWVFISIYQGAVIMYGALL 962
gi 50256015   922 FFAPIALYQGWLQVGYATLYTMAPVFSLVLDKDVneDLALLYPELYKELTKGRslSYKTFFTWLTISVYQGGIIMLLSLL 1001
gi 5101680    825 YFTPITLFTGILLVGYSTFYTMAPVFSLVLDERIslKDIMQFPVLYAEMQKGQnlSFKTFSAWMFISILQGSVIMMLAMI 904
gi 731806     962 LFEPIALYQGWLMVGYATCYTMAPVFSLTLDHDIeeSLTKIYPELYKELTEGKslSYKTFFVWVLLSLFQGSVIQLFSQA 1041
gi 20301938  1075 YLSSVALYQGFLMVGYSTLYTMFPVFSLVLDQDItsETAVTYPELYKDLSKGRslSYKTFFIWVLISIYQGGVIMYGALI 1154
gi 1723470    850 AFEPIALFQGLLLVGYSTMYTMLPVFSIVYDRDVseKLVFLFPELYKEMREQKcfSYKNFISCVLISVYQGLIIQLFTFY 929
gi 385178611  943 YFASVPLYQGFLMVGYATIYTMFPVFSLVLDQDVkpEMALLYPELYKDLTKGRslSFKTFLIWVLISIYQGGILMYGALV 1022
                         970       980
                  ....*....|....*....|....*.
Feature 1                                   
gi 215274251 1034 lfesef---vhvvaiSFTALILTELL 1056
gi 45361309   943 lfesef---vhivaiSFTSLILTELL 965
gi 17559268   963 ifdtdi---lhivsiSFSALIATELI 985
gi 50256015  1002 lfesef---lhivaiSFTALVINELI 1024
gi 5101680    905 lfdssf---vhivsiSFTVLILIELL 927
gi 731806    1042 ftslldtdftrmvaiSFTALVVNELI 1067
gi 20301938  1155 lfvdef---ihivaiSFSALIMTELI 1177
gi 1723470    930 ligfeee--gkmlavCFSCLIFNELI 953
gi 385178611 1023 lfdqef---vhvvaiSFTALILTELL 1045

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap