Conserved Protein Domain Family
P-type_ATPase_cation

?
cd07543: P-type_ATPase_cation 
P-type cation-transporting ATPases, similar to human cation-transporting ATPase type 13A1 (ATP13A1) and Saccharomyces manganese-transporting ATPase 1 Spf1p
Saccharomyces Spf1p may mediate manganese transport into the endoplasmic reticulum (ER); one consequence of deletion of SPF1 is severe ER stress. This subfamily also includes Arabidopsis thaliana MIA (Male Gametogenesis Impaired Anthers) protein which is highly abundant in the endoplasmic reticulum and small vesicles of developing pollen grains and tapetum cells. The MIA gene functionally complements a mutant in the SPF1 from Saccharomyces cerevisiae. The expression of ATP13A1 has been followed during mouse development, ATP13A1 transcript expression showed an increase as development progressed, with the highest expression at the peak of neurogenesis. This subfamily belongs to the P-type ATPases, a large family of integral membrane transporters that are of critical importance in all kingdoms of life. They generate and maintain (electro-) chemical gradients across cellular membranes, by translocating cations, heavy metals and lipids, and are distinguished from other main classes of transport ATPases (F- , V- , and ABC- type) by the formation of a phosphorylated (P-) intermediate state in the catalytic cycle.
Statistics
?
PSSM-Id: 319843
View PSSM: cd07543
Aligned: 12 rows
Threshold Bit Score: 1175.63
Threshold Setting Gi: 19073954
Created: 19-May-2008
Updated: 18-Aug-2016
Structure
?
Aligned Rows:
 
Feature 1: P-type ATPase signature motif, 7 residue positions
Conserved feature residue pattern:D K [TS] G T [LIVM] [TS]Click to see conserved feature residue pattern help
Evidence:
  • Comment:a characteristic P-type ATPase conserved sequence motif: DK[TS]GT[LIVM][TS], in which D is the reversibly phosphorylated Asp

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                         
gi 18202961   214 EIRAAEKKFGSNKAEMVVPDFSELFKERATAPFFVFQVFCVGLWCLDEYWYYSVFTLSMLVAFEASLVQQQMRNMse-iR 292
gi 12229714   170 KIATATEKWGRNVFDYPQPTFQKLMKENCMEPFFVFQVFCVGLWCLDEFWYYSVFTLFMLFMFESTMAKSRLKTLtd-lR 248
gi 27808683   163 HVKDAKYLLGDNKTEMIVPQFLEMFIERATAPFFVFQVFCVGLWCLEDMWYYSLFTLFMLMTFEATLVKQQMKNMse-iR 241
gi 33311805   180 QLRAAEKRYGTNRAEMVVPDFLELFKERATAPFFVFQVFCVGLWCLDEYWYYSVFTLFMLVAFEASLVQQQMRNMse-iR 258
gi 50256210   202 SLEALKATYGLNECHIPIPKFAELFAEHAVAPFFVFQMFCVALWCLDEYWYYSLFTAFMLVVFECTVVFQRVKTLqe-fR 280
gi 183986111  176 DIKAAEKKYGINKAEMVVPDFLHLFKERAIAPFFVFQVFCVGLWCLDEYWYYSVFTLFMLVAFEASLVQQQMKNLse-iR 254
gi 56470618   150 KANEKHEYYGLNKCSIPIPTFMDLYKEQIMQPFFIFQVVCSILWMMDDMPIFAFMMLIMLFIFEGMTTFTRMKNYgnfkA 229
gi 19073954   124 VEAELLKHFKKNRFDIVPPSFSELFLQHAVSPLFVFQVFSGLLWCLDEYVYQAMFSLVMLVVLESGLVFQRMMTArh-fR 202
gi 731415     169 DLTHLKRLYGENSFDIPIPTFMELFKEHAVAPLFVFQVFCVALWLLDEFWYYSLFNLFMIISMEAAAVFQRLTALke-fR 247
gi 19921132   220 DIKRATQTYGNNEMEMVVPEFHELFIERATAPFFVFQVFSVGLWCMDDYWYYSLFTLFMLIAFECTIVKQQLRNMse-iR 298
gi 6707666    169 QSEIFLYRYGKNCFDIPIPTFGTLFKEHAVAPFFVFQIFCCVLWCLDDYWYFSLFSMFMIIALECSVVWQRQRTLte-fR 247
gi 341940257  211 EIRAAEKKFGSNKAEMVVPDFSELFKERATAPFFVFQVFCVGLWCLDEYWYYSVFTLSMLVAFEASLVQQQMRNMse-iR 289
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                         
gi 18202961   293 KMGNKPHMIQVYRs-------RKWRPIASDEIVPGDIVSIGrs-----pqENLVPCDVLLLRGRCIVDEAMLTGESVPQM 360
gi 12229714   249 SVRVDSQTVMVYRs-------GKWVKLLGTDLLPGDVVSIGrpstqtggeDKTVPADMLLLVGSAIVNEAILTGESTPQW 321
gi 27808683   242 NMGNKTYMINVLRg-------KKWQKIKIEELVAGDIVSIGrg-----aeEECVPCDLLLLRGPCIVDESMLTGESVPQM 309
gi 33311805   259 RMGNKPYMIQVYRn-------RKWRPISSDELVPGDIVSVGrs-----pqDNLVPCDVLLLRGRCIVDEAMLTGGSVPQM 326
gi 50256210   281 TMSITPYNVQAFRd-------GKWVSVISSELVPGDLVSILrt-----npDSGIPCDLLLLRGTCIVNEAMLSGESTPLL 348
gi 183986111  255 KMGNKPYMIQVYRn-------RKWRPIPSDEIIPGDIVSIGrs-----anDNLVPCDVLLLRGRCIVDEAMLTGESVPQM 322
gi 56470618   230 MAAMKPTTHTVYRd-------GIKTQVDCDHIYPGDLLVIT---------TGKAIADCVIIKGMCVVNESILTGESTPHM 293
gi 19073954   203 RMSHSNVDVEILYdsrmnakkGEGVMGSSENLFPGDVVKISs--------SIHVPCDLLLVKGSCAVNEAMLSGESVPLT 274
gi 731415     248 TMGIKPYTINVFRn-------KKWVALQTNELLPMDLVSITrt-----aeESAIPCDLILLDGSAIVNEAMLSGESTPLL 315
gi 19921132   299 KMGNKPYLIYAFRq-------NKWRHLGSDELLPGDLVSITrs-----qnDNIVPCDLVILRGSCIVDESMLTGESVPLM 366
gi 6707666    248 TMSIKPYEIQVYRn-------KHWFPISTEDLLPNDVVSVLhn-----keDSGLPCDLLLLSGSCVVNEAMLSGESTPLV 315
gi 341940257  290 KMGNKPHMIQVYRs-------RKWRPVASDDIVPGDIVSIGrs-----pqENLVPCDVLLLRGRCIVDEAMLTGESVPQM 357
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                         
gi 18202961   361 KEPIedlspdrv---ldlqadsRLHVIFGGTKVVQhippqka-ttglkpvDSGCVAYVLRTGFNTSQGKLLRTILFGvKR 436
gi 12229714   322 KVPIvgqrsde----klsikrnKNHVLFGGTKILQhspdks---fslktpDGGCLAVVLRTGFETSQGKLMRTILFStER 394
gi 27808683   310 KEPIedvekdki---fdietdsRLHVIFGGTKIVQhtapgkaaegmvkspDGNCICYVIRTGFNTSQGKLLRTIMFGvKK 386
gi 33311805   327 KEPIedldpnri---ldlqtdsRLHIISGGTKVVQhspplra-saglkpvDNGCVAYVLRTGFYTSQGKLLRTILFGvKR 402
gi 50256210   349 KESIelregtdr---ldmngadRNNVLFSGTKALQvekage---ggmttpDGGCLAVVLRTGFGTTQGQLVRTMIFStER 422
gi 183986111  323 KEPIedlnpeni---ldvsadsKLHVISGGTKVVQhtppqka-tsglkpvDNGCVAYVLRTGFNTSQGKLLRTILFGvKR 398
gi 56470618   294 REALstiidpntendvldlnvhKHHIIFGGTEVLQ---------------DDQCLGYVIHTGFKTAQGELLRTIISStER 358
gi 19073954   275 KEDIserdaed----ifdggrdRRHILYAGTEIVMm-------------kDSPLVCFVLHTGFETEKGGLVRKMMCA-EE 336
gi 731415     316 KESIklrpsedn---lqldgvdKIAVLHGGTKALQvtppehk-sdippppDGGALAIVTKTGFETSQGSLVRVMIYSaER 391
gi 19921132   367 KESLesldnldv--emdaegdgKLFVLFGGTKVVQhtaptk---eslrapDGGCIGYVIRTGFNTSQGKLLRTILFGaNR 441
gi 6707666    316 KESIelrpeeav---idvdeldKNAVLFGGTRVLQvtqspf---cklktpDNGVPAIVLRTGFETSQGSLVRTMVFSsEK 389
gi 341940257  358 KEPIedlspdrv---ldlqadaRLHVIFGGTKVVQhippqka-tsglkpvDNGCVAFVLRTGFNTSQGRLLRTILFGvKR 433
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                         
gi 18202961   437 VTANNLETFIFILFLLVFAIAAAAYVWIEGtkdpsrnRYKLFLECTLILTSVVPPELPIELSLAVNTSLIALAKLYMYCT 516
gi 12229714   395 VTANSWESGLFILFLVVFAVIAAGYVLVKGledptrsKYKLLLGCSLIITSVIPPELPMELSIAVNTSLLALVRRGIFCT 474
gi 27808683   387 ATANNLETFCFILFLLIFAIAAAAYLWIKGsvdetrsKYKLFLECTLILTSVIPPELPIELSLAVNSSLMALQKLGIFCT 466
gi 33311805   403 VTANNLETFIFILFLLVFAIAAAVYVWVEGtkdpsrnKYKLFLECTLILTSVVPPELPIELSLAVNTSLIALAKLYVFCT 482
gi 50256210   423 VSANTFEAFLFIGFLLIFAIAASAYVWIKGler-gmvKGKLLLDCVLIITSVVPPELPMELSLAVNASLVALQKYAIFCT 501
gi 183986111  399 VTANNLETFIFILFLLVFAIAAAAYVWIEGtkdpsrnRYKLFLECTLILTSVVPPELPIELSLAVNTSLIALAKLYVYCT 478
gi 56470618   359 KTANNLESFVVILFLLVFALIAAGYVFIDGink-gksFWKLVLSCVLIITNVVPPELPMELTNAINYSLVSLKKQFIFCT 437
gi 19073954   337 VTVNDREAFIFILALLVFAIVASFYAYREGkkm-gksNYKLLLEVILILTNVVPTELPMELSMAVNSCVRALARKGVYCL 415
gi 731415     392 VSVDNKEALMFILFLLIFAVIASWYVWVEGtkm-griQSKLILDCILIITSVVPPELPMELTMAVNSSLAALAKFYVYCT 470
gi 19921132   442 ATENNVETFAFIAFLMVFAVAAASYVWVKGsedpernRYKLFLECTLILTSIIPPDLPIELTLAVNTSLIQLTKLFVFCT 521
gi 6707666    390 VTANNRESLYFILFLLVFAIAASGYVWHVGskt-ersRYKLMLDCVMIITSVVPSELPMELSMAVNASLGALSKYYIYCT 468
gi 341940257  434 VTANNLETFIFILFLLVFAIAAAAYVWVEGtkdpsrnRYKLFLECTLILTSVVPPELPIELSLAVNTSLIALAKLYMYCT 513
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                         #######                                                         
gi 18202961   517 EPFRIPFAGKVEVCCFDKTGTLTSDSLVVRGVAGLRDGKEVtpvssi----pvethrALASCHSLmq----lDDGTLVGD 588
gi 12229714   475 EPFRIPFAGKVDLCCFDKTGTLTSDDMEFRGVGGLSNCEEAetdmskv---pvrtleILASCHALv-----fVENKLVGD 546
gi 27808683   467 EPFRIPFAGKVDICCFDKTGTLTTDNLVVEGVALNNQKEGMirnaedl---pheslqVLASCHSLv-----rFEEDLVGD 538
gi 33311805   483 EPFRIPFAGKVEICCFDKTGTLTSDSLVVRGVAGLREGKQVmpvsei----pvdthrVVATCHSLvt----lDDGQLVGD 554
gi 50256210   502 EPFRIPWAGRVDVCCFDKTGTITGEDLVVEGIAGVNSADPKalrpvte--snkettlALAAAHALvl----lDDGTIVGD 575
gi 183986111  479 EPFRIPFAGKVEICCFDKTGTLTSDSLVVRGVAGLKDGKEVtpisdi----pldthrVVATCHSLvq----mDDGTLVGD 550
gi 56470618   438 EPFRIPFAGIVDICAFDKTGTLTSDEVSVAGIAGLKDDPFKlrsside--vpqeiinVIVACNSLsk----mKDGSVIGD 511
gi 19073954   416 EPFRIPYAGKVNVCCFDKTGTLTETVMEVAAVKHETENSVS----------------VLASCHSLl-----sLNGKVTGD 474
gi 731415     471 EPFRIPFAGRIDVCCFDKTGTLTGEDLVFEGLAGISADSENirhlysaaeapestilVIGAAHALvk----lEDGDIVGD 546
gi 19921132   522 EPFRIPFAGKVQICCFDKTGTLTTDNLMVEGIAGLAPNGACvpieka----egntvqVLACCHSLa-----lLDDGLVGD 592
gi 6707666    469 EPFRIPLSGHLDICCFDKTGTLTEEHMVVQGIAGVNRKDPYsleklsd--asndailAIATAHTLvlleqegETPKVVGD 546
gi 341940257  514 EPFRIPFAGKVEVCCFDKTGTLTSDSLVVRGVAGLRDGKEVtpvssi----piethrALASCHSLmq----lDDGTLVGD 585
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                         
gi 18202961   589 PLEKAMLTAVDWtltkdekvfp---rsiktqglkIHQRFHFASALKRMSVLASyeklgstdlCYIAAVKGAPETLhsmfs 665
gi 12229714   547 PLEKAALKGIDWsykadekalp---rrgngnsvqIMQRYHFASHLKRMSVIVRiq------eEYLAFVKGAPETIqerlv 617
gi 27808683   539 PLEKACLSWCGWnltkgdavmppktaakgisgikIFHRYHFSSAMKRMTVVAGyqspgtsdtTFIVAVKGAPEVLrnmya 618
gi 33311805   555 PLEKAMLTAADWtltkdekvfa---rstktpglkIHQRFHFTSALKRMSVLASyermgstelCYISTVKGAPETLrnmfs 631
gi 50256210   576 PMEKTTLAALDWklsrgdqispvskespykaqihIRRRYQFSSALKRMSTISSvsds--qgkKWVVAVKGAPETLksmyv 653
gi 183986111  551 PLEKAMLTAVDWtvtkdekvfs---ksiktqglkIHQRFHFASSLKRMSVLASyerpgstdlCYVATVKGAPETLhtmfs 627
gi 56470618   512 PAEKAALEFSKWnltsdgrftp---skktnkqiqPIQRFPFSSLLKRMSVVVAikdfntntkTIMGFVKGAPEILkgmfk 588
gi 19073954   475 PLETSIYEHLRNteplns----------kclehtIHKAYSFCSELRRMTVVVEak------gKRFVGMKGAPEVVkly-l 537
gi 731415     547 PMEKATLKAVGWaverknsny-----regtgkldIIRRFQFSSALKRSASIAShn------dALFAAVKGAPETIrerls 615
gi 19921132   593 PLEKATLAAVDWtltkmdsvip---krpqfkplkIIQRYHFSSALKRMSVLAGhlipysnevKHIGAVKGAPEVIqkmlr 669
gi 6707666    547 PMEKATVENLGWsiekknfvsapegsvfykgkvqIIRNFQFSSALKRQSSVSNvrvs-ggsfKTFVSVKGAPEVIatmlr 625
gi 341940257  586 PLEKAMLTAVDWtltkdekvfp---rsiktqglkIHQRFHFASALKRMSVLASyeklgstdlCYIAAVKGAPETLhsmfs 662
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                         
gi 18202961   666 qcPPDYHHIHTEISREGARVLALGYKELghlthqqa-revkreaLECSLKFVGFIVVSCPLKADSKAVIREIQNASHRVV 744
gi 12229714   618 dvPAQYIETYKRYTRQGSRVLALAYKRLpdmmvsea-rdmdrdaVESDLTFAGFAVFNCPIRPDSAPVLLELKNSSHDLV 696
gi 27808683   619 dlPSDYDETYTRLTRQGSRVLAMGIRKLgetrvgel-rdkkrenFENDLAFAGFVVISCPLKSDTKTMIREIMDSSHVVA 697
gi 33311805   632 ecPASYDEVHREMSREGARVLALGYKEMghlshqqv-revsreqLECDLRFAGFMVVSCPLKSDSKAVIREIQEASHHVV 710
gi 50256210   654 qvPDWYEETYRWYTRRGSRVLALGVKYMdvqadki--nqihrdhVECKLSFAGFLVFHCPLKPDAVETLKMLNDSSHRCV 731
gi 183986111  628 hcPEYYNQVHTEISREGARVLALGYKELghlthqqv-revkremLECDLRFAGFIVVSCPLKADSKAVIKEIQNASHNVV 706
gi 56470618   589 eiPHHYDNVNRFFTLQGMRVLAFGYKAIkngekn----kyirddIESDLEFGGFILFSSPIKKESNETIKQLKESGHDVV 664
gi 19073954   538 dsVPEFYDDYKKYAADGYRVLALGFKPIekqdk------ydrtdVESKLSFAGFILFDCKLKKNVRKTIESLHGSGHKVI 611
gi 731415     616 diPKNYDEIYKSFTRSGSRVLALASKSLpkmsqski-ddlnrddVESELTFNGFLIFHCPLKDDAIETIKMLNESSHRSI 694
gi 19921132   670 evPADYEKVYLEYARRGARVLALGIKDLgtlgaqrv-remkreeVECDLTFAGFLIISCPMKPDSKSVIKELIQSSHKVV 748
gi 6707666    626 evPKDYEKIYKDYGRKGSRVLALGYKYFknyipenqvsdlsresIESDLVFAGFLIFTSPLKEDARQTVQMLNNSSHRCM 705
gi 341940257  663 qcPPDYHHIHTEISREGARVLALGYKELghlthqqa-reikreaLECSLKFVGFIVVSCPLKADSKAVIREIQNASHRVV 741
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                         
gi 18202961   745 MITGDNPLTACHVAQELHFIEKAHtli-lqPPSEKGRQCEWRsidgsivlplargspkalaley------alcltgdgla 817
gi 12229714   697 MITGDQALTACHVAGQVHIVSNPVl-----ILGRSGSGNEYKwvspdekeiipysekeietlae------thdlciggds 765
gi 27808683   698 MITGDNPLTACHVSKVLKFTKKSLptl-vlDEPADGVDWMWKsvdgtielplkpetknkmerkaffn-shefcltgsafh 775
gi 33311805   711 MITGDNPLTACHVARELHFIQKEHt----lILQQSSSQAEWQwvsidgsvslplppssvseliqr-----ydlcvtgegl 781
gi 50256210   732 MITGDNPLTAVHVARDVEIVDREVmi---lDLKEGTTSNELVwrnvdetnvipvnssepfdqslf----knydicitgaa 804
gi 183986111  707 MITGDNPLTACHVAEELNFIEKPHtlilqpAQDTRDSPWLWQsidgtislpafpdnvqaftsny------ylcltgegls 780
gi 56470618   665 MITGDSIFTAAHVAEELTITSKDKv-----MLIKEKEEWKWTdmegleispfntkqvssevinrh-----iclsgealsh 734
gi 19073954   612 MITGDNVLTARNVSKKIGISDKAV------EGSEIDKVLESD-------------------------------------- 647
gi 731415     695 MITGDNPLTAVHVAKEVGIVFGETl-----ILDRAGKSDDNQllfrdveetvsipfdpskdtfdhsklfdrydiavtgya 769
gi 19921132   749 MITGDSPLTACHVARELRFTRKKLii---lTPPEEDRKNNWSwvsidgdqsyeldtkpgskklshllathdlcitgeglq 825
gi 6707666    706 MITGDNPLTAVYVAEQVGIVEKPTlv--ldIKHENEKILEWKstddtinlpmnphksleaslye------kydlcitgra 777
gi 341940257  742 MITGDNPLTACHVAQELHFIDKAHtli-lhPPSEKGQPCEWRsidssivlpltlgspkalaleh------alcltgdgla 814
                         650       660       670       680       690       700       710       720
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                         
gi 18202961   818 hlqatdpqqllrLIPHVQVFARVAPKQKEFVITSLKELGYVTLMCGDGTNDVGALKHADVGVALLanapervverrrrpr 897
gi 12229714   766 iemlqatsavlrVIPFVKVFARVAPQQKELILTTFKAVGRGTLMCGDGTNDVGALKQAHVGVALLnnklplspsdsskdd 845
gi 27808683   776 hlvhnehtflreLILHVKVFARMAPKQKERIINELKSLGKVTLMCGDGTNDVGALKHANVGVALLtnpydaekaaekeke 855
gi 33311805   782 arlkfdpqllsaLLPHVRVFARVSPKQKEFVITSLKGLGFVTLMCGDGTNDVGALKHAHIGVALLanapermpekkkrnk 861
gi 50256210   805 lkqydalpsvtdLIKHTYVYARVSPAQKEFIITTLRSLGYITLMAGDGTNDVGALKAAHIGVALLdgspedlkkiaehqk 884
gi 183986111  781 ylhsarrdmllaLIPHVQVFARVAPKQKEFVITSLKELGYVTLMCGDGTNDVGALKHAHVGVALLanaperlpekkrkpr 860
gi 56470618   735 ikeecskeiiqtILSKTKVYARVTPQQKEEIVLLLKEMGNIVLMCGDGTNDVGALKHADVGIAVLntlpsekekkeaemi 814
gi 19073954   648 ------------EFFSVSIFARADPAHKEKIIEKYNKAGRYTLMCGDGTNDVGALKSAHVGIALMeapvavkkkgepktr 715
gi 731415     770 lnaleghsqlrdLLRHTWVYARVSPSQKEFLLNTLKDMGYQTLMCGDGTNDVGALKQAHVGIALLngteeglkklgeqrr 849
gi 19921132   826 ylqqnqpqymrqLLPQITVCARFAPKQKELVITQLKQLGYCTLMCGDGTNDVGALKHANVGVSLLtsapvkrkrteeeqq 905
gi 6707666    778 lsqiinpdvimsIFTHAWVYARVSPSQKEFMISTLKHNGYITLMCGDGTNDVGALKQAHVGVALLnaseedmlemqerar 857
gi 341940257  815 hlqavdpqqllcLIPHVQVFARVAPKQKEFVITSLKELGYVTLMCGDGTNDVGALKHADVGVALLanapervverrrrpr 894
                         730       740       750       760       770       780       790       800
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                         
gi 18202961   898 dsptlsnsgiratsrtakq----------------------------------------------------rsglppsee 925
gi 12229714   846 kskskksklplepasktitqngegss-------------------------------------kgkippqnrhltaaelq 888
gi 27808683   856 kkakieearslvrsgaqlpqrpgapgappa-----------------------------anaarrdappgararaplppm 906
gi 33311805   862 ekeyssgesrpgppvptsggkls-------------------------------------------sraarqrlmaqree 898
gi 50256210   885 lermkkvyeqqvrisarfnqpppppppalreay------------------------pelvktqqqvakahegakkanpl 940
gi 183986111  861 eaisdgrpsghsfnsnsikpts---------------------------------------------raaknrimsqree 895
gi 56470618   815 klgiipmpakptpkpltpee-------------------------------------------------ierrrrmtpqe 845
gi 19073954   716 e------------------------------------------------------------------------------- 716
gi 731415     850 legmkmmyikqtefmarwnqpqppvpepiahlfppgpknphylkaleskgtvitpeirkaveeanskpvevikpnglsek 929
gi 19921132   906 qaaanaaaiaaqaqananqq-------------------------------------------------lttreralrrr 936
gi 6707666    858 nqklmgvyekqiqlakrfnlptppvppalchafppgpnnphr------ektqeglnkvledletkkasdvqlteaekaae 931
gi 341940257  895 dspvlsnsgprvsrstkq-----------------------------------------------------ksallspee 921
                         810       820       830       840       850       860       870       880
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                         
gi 18202961   926 qptsqrdrlsqvlrdledestpivKLGDASIAAPFTSKLSSIQCICHVIKQGRCTLVTTLQMFKILALNALILAYSQSVL 1005
gi 12229714   889 rqklkkimddlnndegdgrsaplvKLGDASMASPFTAKHASVAPVTDIIRQGRSTLVTTLQMFKILGLNCLATAYVLSVM 968
gi 27808683   907 anaaqarldnlmkeleeeekaqviKLGDASIAAPFTSKYTSIASICHVIKQGRCTLVTTLQMFKILALNALVSAYSLSAL 986
gi 33311805   899 qlaaqkerisqvlreleedqiqvaKLGDASIAAPFTSKLSSIQCICHVIKQGRCTLVTTLQMFKILALNALILAYSQSVL 978
gi 50256210   941 ekfdmatitsklseldedqdvpqiKLGDASCAAPFTSKLSNVSAISNIIRQGRCTLVATIQMYKILALNCLITAYSLSVQ 1020
gi 183986111  896 qqalqrerisqvlkeleedqlqvvKLGDASIAAPFTFKLSSIQCICHVIKQGRCTLVTTLQMFKILALNALILAYGQSVL 975
gi 56470618   846 rseflknelrkafeglpddestvaKFGDASMASPFSCKSIEVTPVCQILKQGRSTLVTTQQMFRILALNCLISAYDLSVL 925
gi 19073954   717 --------ermmesiskdlgedkiNLGDASVAAPFTAKTGSLDSVLDIIRQGRSALVTTIQMYKILALNSLVSAFSLSVL 788
gi 731415     930 kpadlaslllnsagdaqgdeapalKLGDASCAAPFTSKLANVSAVTNIIRQGRCALVNTIQMYKILALNCLISAYSLSII 1009
gi 19921132   937 qehlnqtqarlqnalrdmeeqtmvKLGDASIAAPFTSKSSSIMCVNHIIKQGRCTLVTTLQMFKILALNALIQAYCQSVL 1016
gi 6707666    932 rranlankmfdtlanasddeapklKLGDASVAAPFTSKLAVVSSITNIVRQGRCTLVALVQMHKILALNCLITAYSLSVL 1011
gi 341940257  922 ppashrdrlsqvlrdleeestpivKLGDASIAAPFTSKLSSIQCICHVIKQGRCTLVTTLQMFKILALNALILAYSQSVL 1001
                         890       900       910       920       930       940       950       960
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                         
gi 18202961  1006 YLEGVKFSDFQATLQGLLLAGCFLFISRSKPLKTLSRERPLPNIFNLYTILTVMLQFFVHFLSLVYLYREAQARspekqe 1085
gi 12229714   969 YLDGVKLGDVQATISGVLTAAFFLFISHARPLQTLSAERPHPSVFSVYLFLSLIGQFAVHLTFLVYSVKEAEKHmpeeci 1048
gi 27808683   987 YLDGVKFSDTQATIQGLLLAACFLFISKSKPLKTLSRQRPMANIFNAYTLLTVTLQFIVHFSCLLYIVGLAHEAntekap 1066
gi 33311805   979 YLEGVKFSDFQATLQGLLLAGCFLFISRSKPLKSLSKERPLPNIFNLYTVLTVLLQFAVHFCSLVYLYKGAQTRspprse 1058
gi 50256210  1021 YLDGIKFGDYQVTITGMLMSVCFLCISRAKPVEKLSKERPLGNIFNLYVLLSVLLQFAIHIVALVYITGLSKSLedrgei 1100
gi 183986111  976 YLEGVKFSDFQATLQGLLLAGCFLFISRSKPLKHLSRERPLPNIFNLYTILTVLLQFLVHFCSLVYLYHGALARtearke 1055
gi 56470618   926 KIEGVKNGDVQMTVTGILLSICFLMLSNTQPLDKLSKHHPTKTIFAPFHVLSVLSQAFIHFVVIQLALKWGKEAagpdyk 1005
gi 19073954   789 DCMGVRYGDVQLTASGLLIGFAFMFLTQSRPLEEISKKRPLTNIINPYIVSSVVLQVVVHIASFFIMIGRIRNVetpv-- 866
gi 731415    1010 YMAGVKFGDGQATVSGLLLSVCFLSISRGKPLEKLSKQRPQSGIFNVYIMGSILSQFAVHIATLVYITTEIYKLeprepq 1089
gi 19921132  1017 YIDGIKFSDTQATMQGIFIAACFLFITRAKPLKTLSKVAPLPNIFNFYTISTILSQFAVHFGTLYYLTSQANILappreg 1096
gi 6707666   1012 HLDGIKFGDTQYTISGMLMSVCFYCVSRARPLETLSKERPQAGIFNTYIIGSVLGQFAIHIVTLIYITRVVYLYedplek 1091
gi 341940257 1002 YLEGVKFSDFQATLQGLLLAGCFLFISRSKPLKTLSRERPLPNIFNLYTILTVMLQFSVHFLSLVYLYREAQARspekqe 1081
                         970       980       990      1000      1010
                  ....*....|....*....|....*....|....*....|....*....|....*.
Feature 1                                                                 
gi 18202961  1086 q-------fvdlykeFEPSLVNSTVYIMAMAMQMATFAINYKGPPFMESLPENKPL 1134
gi 12229714  1049 ----------epdasFHPNLVNTVSYMVSMMLQVATFAVNYMGHPFNQSIRENKPF 1094
gi 27808683  1067 ---------vdleakFTPNILNTTVYIISMALQVCTFAVNYRGRPFMESLFENKAM 1113
gi 33311805  1059 q-------fvdlykeFEPSLINSTVYIMSMAMQMATFAINYKGHPFMESLTENRPL 1107
gi 50256210  1101 ----------dlekkFEPTLLNTAIYLLGLSQQVSTFVLNFQGRPFREGIRENPPL 1146
gi 183986111 1056 e-------fvdlykeFEPSLVNSTVYIMSMAMQMATFAINYKGHPFMESLRENKPL 1104
gi 56470618  1006 i--------peedaeFKPTLVNSIVFIVSNIINVTTFAVNYVGEPYRKNITEYKPL 1053
gi 19073954   867 -----------ysekFSPSLMNSALFFLSTTQQISTFLVNYIGRPFRESLLENKKL 911
gi 731415    1090 ---------vdlekeFAPSLLNTGIFIIQLVQQVSTFAVNYQGEPFRENIRSNKGM 1136
gi 19921132  1097 kvklyidmdaeektkYDPNIVSSTVYIICLSLQVATIAVNYKGYPFMESLRSNRML 1152
gi 6707666   1092 ---------vdleetFKPSLLNTAIYLLQLIQQVSTFAINYQGRPFREALSENKGM 1138
gi 341940257 1082 q-------fvdlykeFEPSLVNSTVYIMAMAMQMATFAINYKGPPFMESLPENKPL 1130

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap