4UMV


Conserved Protein Domain Family
P-type_ATPase_Pb_Zn_Cd2-like

?
cd07546: P-type_ATPase_Pb_Zn_Cd2-like 
Click on image for an interactive view with Cn3D
P-type heavy metal-transporting ATPase, similar to Escherichia coli ZntA which is selective for Pb(2+), Zn(2+), and Cd(2+)
Escherichia coli ZntA mediates resistance to toxic levels of selected divalent metal ions. ZntA has the highest selectivity for Pb(2+), followed by Zn(2+) and Cd(2+); it also shows low levels of activity with Cu(2+), Ni(2+), and Co(2+). It is upregulated by the transcription factor ZntR at high zinc concentrations. This subclass of P-type ATPase is also referred to as CPx-type ATPases because their amino acid sequences contain a characteristic CPC or CPH motif associated with a stretch of hydrophobic amino acids and N-terminal ion-binding sequences. This subfamily belongs to the P-type ATPases, a large family of integral membrane transporters that are of critical importance in all kingdoms of life. They generate and maintain (electro-) chemical gradients across cellular membranes, by translocating cations, heavy metals and lipids, and are distinguished from other main classes of transport ATPases (F- , V- , and ABC- type) by the formation of a phosphorylated (P-) intermediate state in the catalytic cycle.
Statistics
?
PSSM-Id: 319846
View PSSM: cd07546
Aligned: 9 rows
Threshold Bit Score: 794.686
Threshold Setting Gi: 83592363
Created: 13-Jan-2009
Updated: 18-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
 
Conserved site includes 7 residues -Click on image for an interactive view with Cn3D
Feature 1: P-type ATPase signature motif, 7 residue positions
Conserved feature residue pattern:D K [TS] G T [LIVM] [TS]Click to see conserved feature residue pattern help
Evidence:
  • Comment:a characteristic P-type ATPase conserved sequence motif: DK[TS]GT[LIVM][TS], in which D is the reversibly phosphorylated Asp

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
4UMV_A       139 AISWGLEQFNHPFGQLAFIATTLVGLYPIARQALRLIKSGSYFAIETLMSVAAIGALFIGATAEAAMVLLLFLIGERLEG 218
gi 125555837 174 VVSWVLDRINPELGRIAFIATTLVGLAPVAAKALRLIRSGTPFAIETLMSVAAIGALFIGATAEAAMVLLLFMVGELLES 253
gi 15807741  129 ALAWVFGRFEPAWAQWGYAAAALLGAWPLAKKAWASVRLGDPFSINLLVTLAAIGAVAIGQAAEGAVVVFLFAVGELLEG 208
gi 159184493 303 AIAYAAELTFPAWGSYAFIVATLATLFPIARNAFNAARFGAVFTIEMLMTIAAIGAIIIGEAEEAAIVVLLFSVGELLEG 382
gi 59712129  170 VIATGINIVNKELGTIAFTVAGLFGLIPIGRKAIRLAKNGSPFSIETLMTVAAIGAVYLGETVEAAMVILLFMLGEQLEG 249
gi 77462336  137 CAWTVEALVPGPVGPVAFALACLIGLVPIARRAFAALRLGQPFTIEGLMTVAAAGALFIGAAEEAALVIFLFAVGEVLEG 216
gi 83592363  172 AVAYGLGLVFPPLADGLFIAAMLIGLLPIARRAFTSARYGSPFSIETLMTVAALGAVALGAVEEAAAVVFLFLVGEALEG 251
gi 15641046  168 LMAIGALVNSSEMSRWIYTLTCLLGLFPILQQAWRLAKSGSPFSIETLMSVAAIGALYLGETLEAAMVLLLFLIGERLEA 247
gi 586655    139 AISWGLEQFNHPFGQLAFIATTLVGLYPIARQALRLIKSGSYFAIETLMSVAAIGALFIGATAEAAMVLLLFLIGERLEG 218
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
4UMV_A       219 WAASRARQGVSALMALKPETATRLRn-GEREEVAINSLRPGDVIEVAAGGRLPADGKLLSPfASFDESALTGESIPVERA 297
gi 125555837 254 YAANRARRGVKALMELVPEDALLLQg-TERKRVPVASLRPGDVIEIAPGGRLPADAELLNPfASFDESALTGESVPVERQ 332
gi 15807741  209 VAAGRARAGIATLAALAPKTALLVEp-GGVREVPADTLQVGQTVQVGPGARVPADGTITAGqSSLDDSPVTGESVPVSKG 287
gi 159184493 383 FAAARARSGIKALGSLLPKTALVEEn-GSLRQIAADQVRIGQVVVARPGDRIAADGVVMEGqSSVDESPMTGESIPVAKE 461
gi 59712129  250 YASAKARSGVKALMDLVPDTALRINsdGTKEEVAASELNVGDRVQVSPGDRLAADAILLSEfASFDESALTGESVPVDKK 329
gi 77462336  217 VAASRARDGIRALSRLVPETARLEQd-GRTLEVPAAGLQPGQIVRVRPGERIPADGEILEGqGGLDESPVTGESIPVTRG 295
gi 83592363  252 LAAGRARAGIRALSALVPKTAQREGadGGVREVLADRLAIGDVIVVRPGDRVPADGLVLSGnGEVDEAPVTGESLPKAKA 331
gi 15641046  248 YAASRARTGVQALMALVPETAIRIEh-GERVTVPAAQLQPGDVIEVAPGGRLPADGRLLAA-ASLDNSALTGESLPVELT 325
gi 586655    219 WAASRARQGVSALMALKPETATRLRk-GEREEVAINSLRPGDVIEVAAGGRLPADGKLLSPfASFDESALTGESIPVERA 297
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
4UMV_A       298 TGDKVPAGATSVDRLVTLEVLSEPGASAIDRILKLIEEAEERRAPIERFIDRFSRIYTPAIMAVALLVTLVPPLLFAASW 377
gi 125555837 333 RGEKVAAGSLSVDQAAQMKVISEPGKNAIDRILQLIEEAEERRAPIERFLDRFSRYYTPAIMLLAVAVILVPPLLFSQPW 412
gi 15807741  288 PGDHVYAGSINTDGVLTVRVDRAAADNTIARIIHLVEEAESSKAPTARFIDRFSRWYTPGVVAVAALTAALPPLLLGQPW 367
gi 159184493 462 KGARVFAGSINHDGSLRIRVDRAPEDNTIARIITLVEEAQDARAPTERFIQSFSRYYMPLIVAISALTIVVPPLVGLGDW 541
gi 59712129  330 ANDPLMAGSIVNDRVIEIQITSAQGENAIDRILHLIEEAESRKAPLERFLDKFSRWYTPAMMVLSLLVIIIPPLMFGQSW 409
gi 77462336  296 PGEAVFAGAVATDAALRIRVTRAAKDNTIARIVRLVEEAEEARAPTERFIDRFSRWYMPLIVGLAVAVAVLPPLAAGADW 375
gi 83592363  332 AGDGLFAGTINGIGLLRVRVTAAAADNTIARVVRLVEEATESKAPIARFIDRFARLYTPAVIAAALAVAVLPPMVLGGAW 411
gi 15641046  326 AGERVSAGCVIVDKVVQIEITSKQGENAIDRILHMIEEAESRKAPLERFLDKFSRWYTPLMMLVALAVIVVPPLAFGADW 405
gi 586655    298 TGDKVPAGATSVDRLVTLEVLSEPGASAIDRILKLIEEAEERRAPIERFIDRFSRIYTPAIMAVALLVTLVPPLLFAASW 377
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                  #######               
4UMV_A       378 QEWIYKGLTLLLIGCPCALVISTPAAITSGLAAAARRGALIKGGAALEQLGRVTQVAFDKTGTLTVGKPRVTAIHPATgi 457
gi 125555837 413 ETWIYRGLTLLLIGCPCALVISTPAAITSGLAAATRRGALIKGGAALEQLGQIQTIAFDKTGTLTEGKPTVTDVLPIGal 492
gi 15807741  368 YPWLYKGIALLLIGCPCALVLSVPAAITSGISAGTRRGLLIKGGAALETIGSVRTIAFDKTGTLTSGRPRVTDVLADN-- 445
gi 159184493 542 DTWIYRGLALLLIGCPCALVISVPAAIASSLSAAARHGMLVKGGAVIEMLARTETVAFDKTGTLTLGEPVVTDVVALDg- 620
gi 59712129  410 DTWIYRGLAMLLIACPCALVISTPAAITSGLATAAKRGALIKGGAALEELGHIQNIAFDKTGTLTQGKPVLTDIRVLTet 489
gi 77462336  376 STWIYRGLALLLIGCPCALVISVPAAIASALASGARRGLLMKGGAVIEAAAAVRQVAFDKTGTLTRGRPEVTDVVTLSve 455
gi 83592363  412 ETWIYRALALLLIGCPCALVISTPAAIAAGLSAGARRGLLIKGGAVLEILGKVTTVAFDKTGTLTRGEPVVTDLQARAl- 490
gi 15641046  406 QTWIYRGLALLLIACPCALVISTPAAITSGLAAAARRGALIKGGAALEQLGKIETIAFDKTGTLTEGKPQVTDLIPLQgw 485
gi 586655    378 QEWIYKGLTLLLIGCPCALVISTPAAITSGLAAAARRGALIKGGAALEQLGRVTQVAFDKTGTLTVGKPRVTAIHPATgi 457
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
4UMV_A       458 -sESELLTLAAAVEQGATHPLAQAIVREAQVAELAIPtAESQRALVGSGIEAQVNGERVLICAa----GKHPADAf---- 528
gi 125555837 493 -tEQRLLQLAAAVEAGSHHPLAQAIINRAAASGAELPlAQARRALAGVGVEGIVDDKTVLISApgklaPGLLATQw---- 567
gi 15807741  446 --PAELLRLAAAVETGSSHPLAQAITAEAQARGLTVPaASEARALPGQGVTALVEGRPVQVTS-----PIFAASQatls- 517
gi 159184493 621 -nEAELIAQAATIENESSHPLARAIVSHANKAGVIPLpGSEIKAISGRGMQGNVGGKRLFIGA-----PRFATDVgtvs- 693
gi 59712129  490 etEESILLQSAAVEMGSSHPLARAVVVKAQEQGLTVIeADNRETVVGKGIKGTVNEQHIELYA-----PQQFDGEvip-- 562
gi 77462336  456 -sEVRVLALAAAVERGSAHPLAQAILARAEAAGAPDLpAEAARSLAGRGAEARVEGEDLWVAS-----PSFAAERgvld- 528
gi 83592363  491 -sAGEALALAAGLAEGSSHPVSRAILARARLDAILPRrIDDAGTRAGEGLDGTVDGEALFLGS-----PKAARRRmggfe 564
gi 15641046  486 -dSATLLARAAAIEMGSHHPLATSLVAKAQAEQLTIPqAQERTALVGRGISGQIDGVQYRLLA-----PNRVETKlpd-- 557
gi 586655    458 -sESELLTLAAAVEQGATHPLAQAIVREAQVAELAIPtAESQRALVGSGIEAQVNGERVLICAa----GKHPADAf---- 528
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
4UMV_A       529 ---AGLINELESAGQTVVLVVRND----DVLGIIALQDTLRADAATAISELNALGVKGVILTGDNPRAAAAIAGELGLEF 601
gi 125555837 568 ---QSQVDKLENAGKTAVVVLADG----APIGLLALRDTLRSDAKQAIAELNALGIRGVMLTGDNPRAAAAIAGELGLDY 640
gi 15807741  518 aeqQQTVATLEQQGRTVVVGLDGG----RVLGLIALRDEPREDAREALAELRRLGIRPLMLTGDNARTGQAVAADLGLDV 593
gi 159184493 694 nelAERISALESEGKTVAVVMAEG----VASGLFAMRDEPRKDAAEGIKALKDMGISSLMLSGDNARTARAIGNKLGLEA 769
gi 59712129  563 -eiESQIAFLEQQGKTVVLVLINE----QISGLLAWRDELRPDAKMAVEKLVKLGIKPIMLTGDNERAAKAIAAELNIDY 637
gi 77462336  529 agtRARAEALEAEGKTVTVLFREG----RTLGLLALRDEPRGDAAEAVRQLGRMGVSATILTGDNARTAEAIAARLGTGF 604
gi 83592363  565 ddvDGAILALEQAGKTVSLLVLGEgataRVGAVFGLRDEPRPDAGEGVAALKAAGVEAMMLTGDTPHAARALGQGLDIAV 644
gi 15641046  558 -vvKQHVEMLEAESKTVVVMLASD----AVVGVIAWQDTLRSDARQAVAALHQLGINALMLTGDNERSAAAMSQQLNMDF 632
gi 586655    529 ---TGLINELESAGQTVVLVVRND----DVLGVIALQDTLRADAATAISELNALGVKGVILTGDNPRAAAAIAGELGLEF 601
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
4UMV_A       602 KAGLLPEDKVKAVTKLNQHAp-LAMVGDGINDAPAMKAAAIGIAMGSGTDVALETADAALTHNHLRGLVQMIELARATHA 680
gi 125555837 641 RAGLLPEDKVAAVTELNELRp-TAMIGDGINDAPAMKASNIGIAMGSGTDVALETADAALTHNRLVGVAEMIRISRATHA 719
gi 15807741  594 QAELLPADKLNIIDELRAQGg-VAMVGDGINDAPALARADVGIAMGSGTDVALETADAALLRGQVQGVGELVQLSRDTLA 672
gi 159184493 770 RGELLPQNKVEEIRKLAEKKt-VVMVGDGINDAPALAAASVGVAIGSGTDVAMEAADAALMRNNVGDAARLIGLSRATMS 848
gi 59712129  638 KAGLLPSDKVKYVEQLTANAk-TAMVGDGINDAPAMKTASIGIAMGGGTDVALETADAALTHNRLEELAPMVALSKATLS 716
gi 77462336  605 RAQMRPDDKLAAIREMAGQGg-VMMIGDGINDAPALKAASVGVAMGSGTDVALETADAAILRDRVTDVPATIRLARAAMR 683
gi 83592363  645 HAGLMPEDKLRLVRERQNRGalVAVVGDGINDAPALAAADVGIAMGGGTDVALETADAAILRSRVGDVAAMIDLSKRTLA 724
gi 15641046  633 RAGLLPQDKVGYIQQLAQHQr-VAMVGDGINDAPAMKEASIGIAMGGGTDVALETADAALTHNRLIELPGMIELSRATLA 711
gi 586655    602 KAGLLPEDKVKAVTELNQHAp-LAMVGDGINDAPAMKAAAIGIAMGSGTDVALETADAALTHNHLRGLVQMIELARATHA 680
                        570       580       590       600       610
                 ....*....|....*....|....*....|....*....|....*....|..
Feature 1                                                            
4UMV_A       681 NIRQNITIALGLKGIFLVTTLLGMTGLWLAVLADTGATVLVTANALRLLRRR 732
gi 125555837 720 NIRQNITIALGLKGVFLITSLLGLTGLWLAVLADSGATALVTANALRLLRKR 771
gi 15807741  673 NIRQNVAFALGLKAIFLVTTLLGYTNLWMAVLADTGATAIVTANALRLLNWR 724
gi 159184493 849 NIRQNVTIALGLKAVFLVTTVTGVSGLWLAVFADTGATVLVTANAMRLLGYF 900
gi 59712129  717 NIHQNITLALGLKAVFLVTSLFGITGLWVAVLADSGATALVTLNALRLLRFK 768
gi 77462336  684 NIRQNIAVALGLKGVFLVTSVLGITGLWIAILADTGATVLVTLNALRLLRFD 735
gi 83592363  725 IIHQNVAIALGLKALFLVTTVAGLTGLWPAILADTGATVLVTANALRLLRRR 776
gi 15641046  712 IIRQNVVLALGLKAVFLVTSLLGITGLWMAVLADSGATALVTLNALRLLKFR 763
gi 586655    681 NIRQNITIALGLKGIFLVTTLLGMTGLWLAVLADTGATVLVTANALRLLRRR 732

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap