Conserved Protein Domain Family
P-type_ATPase_Cu-like

?
cd07552: P-type_ATPase_Cu-like 
P-type heavy metal-transporting ATPase, similar to Archaeoglobus fulgidus CopB, a Cu(2+)-ATPase
Archaeoglobus fulgidus CopB transports Cu(2+) from the cytoplasm to the exterior of the cell using ATP as energy source, it transports preferentially Cu(2+) over Cu(+), it is activated by Cu(2+) with high affinity and partially by Cu(+) and Ag(+). This subclass of P-type ATPase is also referred to as CPx-type ATPases because their amino acid sequences contain a characteristic CPC or CPH motif associated with a stretch of hydrophobic amino acids and N-terminal ion-binding sequences. This subfamily belongs to the P-type ATPases, a large family of integral membrane transporters that are of critical importance in all kingdoms of life. They generate and maintain (electro-) chemical gradients across cellular membranes, by translocating cations, heavy metals and lipids, and are distinguished from other main classes of transport ATPases (F- , V- , and ABC- type) by the formation of a phosphorylated (P-) intermediate state in the catalytic cycle.
Statistics
?
PSSM-Id: 319850
View PSSM: cd07552
Aligned: 18 rows
Threshold Bit Score: 939.806
Threshold Setting Gi: 42558783
Created: 19-May-2008
Updated: 18-Aug-2016
Structure
?
Aligned Rows:
 
Feature 1: P-type ATPase signature motif, 7 residue positions
Conserved feature residue pattern:D K [TS] G T [LIVM] [TS]Click to see conserved feature residue pattern help
Evidence:
  • Comment:a characteristic P-type ATPase conserved sequence motif: DK[TS]GT[LIVM][TS], in which D is the reversibly phosphorylated Asp

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
gi 2650494    65 STLLTIPILILSPAIQtfl--gfRVEFAGSLYILFLLSSAVYFYGGYPFLKGIFdELRRRQPGMMTLIAVAISVAYFYSS 142
gi 42558783   74 SLALSVPVVYFSPMFAhll-gyhIPEFPGSLWIPPVLGSVIFFYGGTPFLKGGWtELRSRQPGMMLLIAMAITVAFVASW 152
gi 2621844    45 CLLMTIPVILLGELPTgn----vLFSFEGSEFLVLILSSAIFLYGGYPFLRGSLrELSSRTPGMMTLIAVAITVAYTYSL 120
gi 55981702   54 SLLLTLPILYFSEQLQtwl-gyrALAFPGSAWVNPVLGTILYFYGGLVFLKGALgELRERAPGMMTLIALAITVAYGYSL 132
gi 2983590    35 TTILTVPVVVLSPSIQeli--giKVSFPYSNWVILLLSTAVFIYGGTFFLKGMLeELKKKNPGMMTLVGLAISVAYIYSV 112
gi 416666    110 SLILAIPIILFSPMMGmsf--pfQVTFPGSNWVVLVLATILFIYGGQPFLSGAKmELKQKSPAMMTLIAMGITVAYVYSV 187
gi 157931849  74 SVVLAIPVLLLAPIMGlnvsilsFSSPLIVGIIIVLFDTALYFYGGMPFLKGAKaEIQNKSPEMMTLVTLGISVSYFYSL 153
gi 380033874  40 ALVLTIPIIIMSPMMGvnl-pfqIVFRPWSDYIVAILGTILFLYGGQPFFSGAKaEVKNHKPAMMTLITMGISVAYVYSI 118
gi 29375460   62 SLILAIPIIVLSPMMGfql--pfQFTFPGSDWLVLILATVLFFYGGQPFLSGARmELQQKSPAMMTLIAMGISVSYFYSL 139
gi 74514552   65 STLLTIPILILSPAIQtfl--gfRVEFAGSLYILFLLSSAVYFYGGYPFLKGIFdELRRRQPGMMTLIAVAISVAYFYSS 142
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
gi 2650494   143 AVVFGl-------kGKFFFWELATLIDIMLLGHYIEMRSVLGASRALEELVKIMPSEAHLLkd-gEIVEVKVENLKPGDK 214
gi 42558783  153 ITTLGig-----nfNLDFWWELALLVVIMLLGHWIEMRALGSARGALDALAELLPDEAERIte-hGTETVSISELSVNDV 226
gi 2621844   121 GVILGl-------eGMVFFVELVTLIDVMLLGHWIEMRSIMSASGAVERLAGLLPRRAHLVvd-gKVEDVDVSTLKPGDI 192
gi 55981702  133 AVSLGl-------pGMPFYWELATLIDVMLLGHWLEMASVQAASRALEELAKLMPATAHRItg-dRIEDVPVTALKEGDL 204
gi 2983590   113 YTFFFg--------GKEFFWELTTLIVVMLWGHYVEMKSVLGAGRALEELVKLIPSKAHLVtq-kGLIDVPVEKLKKGDL 183
gi 416666    188 YSFIAnlin-phthVMDFFWELATLIVIMLLGHWIEMNAVSNASDALQKLAELLPESVKRLkkdgTEETVSLKEVHEGDR 266
gi 157931849 154 YAFIAnnflnptnhIMDFSFELATLILIMLLGHWIEMNALMGAGNALQKMAALLPKTAHLVtdngETKEVPVSDLKVGQA 233
gi 380033874 119 YAVVAngllnakpmVTDFFWELATLIVIMLLGHWIEMNTVMNAGSAVDKLAKLLPSTAHKLvd-gQVHDVAIADLANGDQ 197
gi 29375460  140 YAFYMnhft-nqahVMDFFWELATLIVIMLLGHWIEMNAISNAGDALKKMAELLPDTVKRMte-hGEEEIPLQDVQEGDR 217
gi 74514552  143 AVVFGl-------kGKFFFWELATLIDIMLLGHYIEMRSVLGASRALEELVKIMPSEAHLLkd-gEIVEVKVENLKPGDK 214
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
gi 2650494   215 VLVKPGEKIPVDGIVVEGeSFVNEAMLTGESKPVAKKPGDTVIGGAINGEGSLVVEVEKTGKDTYLNQVIELVRQAQESK 294
gi 42558783  227 VLVRSGARLPADGEIIEGrAELDESMITGESKTVPRGPGDTVVAGTVATDSAVRIRVGAVGTDTALAGIQRLVAEAQASS 306
gi 2621844   193 VVVRSGERVPSDGTVIRGeSHVNESLLTGESRPIKKVPGDGVIGGSINTGGSLTVEVERVGEESFISQIIELVGRAQEGR 272
gi 55981702  205 ILVRPGEQVPADGVVEEGaSSVNEAFLTGESRPVPKGVGDEVLAGAVNGEGSLKVRVTRTGEATTLSQVMRLVQEAQASR 284
gi 2983590   184 VLVRPGEKIPTDGTVVEGnTHVDESMLTGESRPVPKKPGDKVIGGSVNLEGSIKVRVEKTGEETYLKQVIKLVKEAQESK 263
gi 416666    267 LIVRAGDKMPTDGTIDKGhTIVDESAVTGESKGVKKQVGDSVIGGSINGDGTIEITVTGTGENGYLAKVMEMVRKAQGEK 346
gi 157931849 234 FQVRSGESIPADGVITAGeSTVNEALVTGESAAVTKNVGDKVIGGTTNNNGTLTVKISGTGDSSYLSQVMKMVQNAQQAK 313
gi 380033874 198 VQVRAGEQIPADGTVLNGaTSVNEAMVTGEAKLVEKRAKDQVVGGSVNGDGTFEMKVTGTGESGYLAQVMKLVSDAQAAK 277
gi 29375460  218 LIVRSGDKIPTDGKILKGsTTVDESMVTGESKTVEKNIGDSVIGGAVNGNGMIEISVTGTGENSYLSKVMEMVKQAQSEK 297
gi 74514552  215 VLVKPGEKIPVDGIVVEGeSFVNEAMLTGESKPVAKKPGDTVIGGAINGEGSLVVEVEKTGKDTYLNQVIELVRQAQESK 294
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
gi 2650494   295 SRTQdLANRAALLLTVIALTVGSVTLAIWLAYiaDFAFAIERAVTVMVITCPHALGLAIPLVVAVSTSLAAKSGLLIRDR 374
gi 42558783  307 SKAQaLADKAAAFLFYFALGAGIITFIAWVLLg-SPDEAVIRTVTVLVIACPHALGLAIPLVIAISTEQAARAGVLIKNR 385
gi 2621844   273 TRTQvLADKAAFWLTSIALLGGLLTFIAWSWLgmDVFFSLERAVTLMVTACPHALGLAIPLVIAVSTAISAGRGILIRNR 352
gi 55981702  285 SRFQaLADRAAGWLFYIAVALGMLTFLVWLALgrDFNFALSLAVTVLVIACPHALGLAIPLVTVNATALAAKNGILVRNR 364
gi 2983590   264 TKLQsLADRAAFYLTVIAVSLGSISLLFWWYYlgDLNFAVERAVTVMVTACPHALGLAIPLVVSISTSYSARNGILVRNR 343
gi 416666    347 SKLEfLSDKVAKWLFYVALVVGIIAFIAWLFLa-NLPDALERMVTVFIIACPHALGLAIPLVVARSTSIAAKNGLLLKNR 425
gi 157931849 314 SKAEdKADLVAKYLFYAALGVGIIAFFAWLPQ--GLATAMTIMVTVFVIACPHALGLAIPLVVSRSTTIGAQNGLLVRNR 391
gi 380033874 278 SSQEnMADKVAGLLFYAALTVAIVAFIVWLLVg-NLALALSIAVTVLVIACPHALGLAIPLVVARSTAIAASHGLLIRNR 356
gi 29375460  298 SKLEsISDRVAKWLFYIALFVGVLAFIGWLMAtkDLSLAFERMVTVFIIACPHALGLAIPLVIARSTSIAAKNGLLLKNR 377
gi 74514552  295 SRTQdLANRAALLLTVIALTVGSVTLAIWLAYiaDFAFAIERAVTVMVITCPHALGLAIPLVVAVSTSLAAKSGLLIRDR 374
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                      #######                                                           
gi 2650494   375 QAFERAKDLQAVIFDKTGTLTEGRFGVTDIVGf--nHSEDELLQIAASLEARSEHPIAAAIVEEAEKRGFglteVEEFRA 452
gi 42558783  386 IALERMRTIDVVLFDKTGTLTKGQPGLTGVAAie-eMNDDDVLALAAAVEADSEHPSARAIVTAARERGLrvpaASGFAS 464
gi 2621844   353 ESFENARDPDVVVFDKTGTLTMGELGITDVISfdpeMDEGEILSYAAAVESGSSHPIARGIVEAVAEVLP----VENFNS 428
gi 55981702  365 EAFERGREIRFVALDKTGTLTEGRFAVRAVYAh--eTSEEEALSLAAALEALSEHPLAQAIVEAAEGKGLprpeVRDFQA 442
gi 2983590   344 LALEKAKDIDVVVFDKTGTLTEGKLGVTEVITk--dIEEGEFLKFVASVENHSEHVIARAIVSYAKEKEE----VKNFKA 417
gi 416666    426 NAMEQANDLDVIMLDKTGTLTQGKFTVTGIEIldeaYQEEEILKYIGALEAHANHPLAIGIMNYLKEKKItpyqAQEQKN 505
gi 157931849 392 QAIEASQHVSHVLLDKTGTLTEGKFTVNALIPnd-gIDETTLLSRLAALEINSTHPLAQAIITEAQAKNIevvaAEKSQN 470
gi 380033874 357 DAMEQVKKLNYALMDKTGTLTAGNFKVADYQSsayrLTADAVLAMMAGLENGSSHPLAVGILAAAKEHQLtpkvSQDVHQ 436
gi 29375460  378 NALEQANKVEYVLLDKTGTLTEGQFTVTGLELmskqFTREEALKYIGALEKNANHPLAIGIMNYLNKQAVqpyeAHNLQA 457
gi 74514552  375 QAFERAKDLQAVIFDKTGTLTEGRFGVTDIVGf--nHSEDELLQIAASLEARSEHPIAAAIVEEAEKRGFglteVEEFRA 452
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
gi 2650494   453 IPGKGVEGIVNGRRYMVVSPGYIRElgiktdESVEKlk----qqGKTVVFILKNGEVSGVIALADRIRPESREAISKLKA 528
gi 42558783  465 LTGRGVKADIGASAVMVGGPNLIAAeglgvpSELREqtrpwverGASVLHVIRAGEVIGAVSLEDEVREESRQAITALQK 544
gi 2621844   429 LEGRGVMGHVNGSVVKVLSYGYTEElgfsisDPRVDeli---gqAKTTVFVIVDDELRGCIALADMIRPEAREAVGILRS 505
gi 55981702  443 VPGKGVEGTLGGKRYRVGRPEWAEElglkvsEPLKRglkeaearGESVVALMDEARVLALLALADRIRPSAKEAIRRLKA 522
gi 2983590   418 FPGKGVCGEVSGRNVCVGTLEFLKEinvkldEELVErarslqseGKTVVFASMDGKLAGIIALADRIKEESYEAVRSLKE 497
gi 416666    506 LAGVGLEATVEDKDVKIINEKEAKRlglkidPERLKnye---aqGNTVSFLVVSDKLVAVIALGDVIKPEAKEFIQAIKE 582
gi 157931849 471 IPGVGISGNVDGTDYMIVNGNYLTKqgirfdEAAADkwa---akGNSVSFLLQGTQVQGMVAEGDTIKAGAKELISGLQR 547
gi 380033874 437 ITGVGLSGTIDGQTYQIVSAAYLDKqnlaydQQTFNrla---saGNSVSFLIQEQTVLGFVAQGDQIKPEAKNLIDSLKA 513
gi 29375460  458 LSGVGLVATVQNQEVKIVNEKEVARlqltfdETIKTnyq---eqGNTLSYLIIAGQLVALLALGDKVKPEAKTFIAELQA 534
gi 74514552  453 IPGKGVEGIVNGRRYMVVSPGYIRElgiktdESVEKlk----qqGKTVVFILKNGEVSGVIALADRIRPESREAISKLKA 528
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
gi 2650494   529 IGIKCMMLTGDNRFVAKWVAEELGLdDYFAEVLPHEKAEKVKEVQQKYv-TAMVGDGVNDAPALAQADVGIAIGAGTDVA 607
gi 42558783  545 RGIRVAMITGDAHQVANAVAAELNIdEVFAQVLPQDKDKKVGELQSRGlkVAMVGDGVNDSPALARAEVGIAIGAGTDVA 624
gi 2621844   506 RGVRCLMLTGDSSAVAGWVASEVGIdDYMAELIPIEKYDEIRKLQEEGlrVVMVGDGVNDAPALVQADIGVAIGAGTDVA 585
gi 55981702  523 MGITPVMITGDAEAVARTVAQELGIeRYHARVLPEDKARRVRELKREGp-TAFVGDGINDAPALLEADLGIAIGAGTNVA 601
gi 2983590   498 LGKKVVMITGDSEEVAKYVAKELEMdEYFARVLPHEKAQKIKELQDRGysVAMVGDGVNDAPALIQADVGIAIGSGTDIA 577
gi 416666    583 KNIIPVMLTGDNPKAAQAVAEYLGInEYYGGLLPDDKEAIVQRYLDQGkkVIMVGDGINDAPSLARATIGMAIGAGTDIA 662
gi 157931849 548 RGITPVMLTGDNPKAAEHVANLLGLtEFHAGLLPDDKQKIIADYQAKGnhVIMVGDGVNDAPSLAAADIGIAIGAGTDVA 627
gi 380033874 514 QNITPVMLTGDNPQSAQVVAKQLGItEVHAGLLPEDKAKLVQQYQADGshVMMIGDGVNDAPSLARADIGVAIGSGTDVA 593
gi 29375460  535 QGITPVMLTGDNQTAASAVANYLGMkEYYAELLPEDKEKIVQQYLTEGhqVMMVGDGINDAPSLARASIGIAIGAGTDVA 614
gi 74514552  529 IGIKCMMLTGDNRFVAKWVAEELGLdDYFAEVLPHEKAEKVKEVQQKYv-TAMVGDGVNDAPALAQADVGIAIGAGTDVA 607
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
gi 2650494   608 VETADIVLVRNDPRDVAAIVELSRKTYSKMKQNLLWATGYNAFAIPLAAGVLYSAGILLSPAVGAILMSLSTVIVAINAR 687
gi 42558783  625 MESAGVVLAGNDPRAVLSMVDLSRASYRKMIQNLVWATGYNVIAVPLAAGVLAFAGVAISPAVAAVLMSVSTIVVALNAQ 704
gi 2621844   586 IESADVVLVRSNPLDVVDLMDLAAATYSKMKENLIWATGYNVIALPLAAGVLYGQGIILSPAMGAILMSLSTVIVALNAR 665
gi 55981702  602 IEAADLVLVESDPLDVVRALTLARATHAKMVQNLFWATGYNAIALPLAAGVAYPWGIVLSPAVGALLMSLSTVAVAVNAM 681
gi 2983590   578 IESADVILVKSDPRDVVKVIKLSQVTVSKMLQNLFWAVGYNVITLPLATGLGYPWGFVLKPAVGAIFMSASTVIVALNSM 657
gi 416666    663 IDSADVVLTNSDPKDILHFLELAKETRRKMIQNLWWGAGYNIIAIPLAAGILAPIGLILSPAVGAVLMSLSTVVVALNAL 742
gi 157931849 628 IDSADVVLVKSEPSDILHFLDLAKITNRKMVQNLWWGAGYNVVAIPLAAGVLSFIGIILDPAVGAAVMAMSTIIVAINAM 707
gi 380033874 594 IDSADIVLVKSNPNDVVDFLALARRTTRKMAQNLWWGAGYNVITIPLAAGILAPLGFILNPMFGAVVMSLSTVIVAINAM 673
gi 29375460  615 IDSADVVLTDSDPKDILRFLDLAKQTRRKMIQNLWWGAGYNIVAIPLAAGVLAPIGIVLNPAVGAVLMSLSTIIVAANAM 694
gi 74514552  608 VETADIVLVRNDPRDVAAIVELSRKTYSKMKQNLLWATGYNAFAIPLAAGVLYSAGILLSPAVGAILMSLSTVIVAINAR 687

                 ...
Feature 1           
gi 2650494   688 LLR 690
gi 42558783  705 LLR 707
gi 2621844   666 TFS 668
gi 55981702  682 LLR 684
gi 2983590   658 LMK 660
gi 416666    743 TLK 745
gi 157931849 708 GLT 710
gi 380033874 674 TLR 676
gi 29375460  695 TLH 697
gi 74514552  688 LLR 690

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap