Conserved Protein Domain Family
P-type_ATPase_HM

?
cd07553: P-type_ATPase_HM 
P-type heavy metal-transporting ATPase; uncharacterized subfamily
Uncharacterized subfamily of the heavy metal-transporting ATPases (Type IB ATPases) which transport heavy metal ions (Cu(+), Cu(2+), Zn(2+), Cd(2+), Co(2+), etc.) across biological membranes. The characteristic N-terminal heavy metal associated (HMA) domain of this group is essential for the binding of metal ions. This subclass of P-type ATPase is also referred to as CPx-type ATPases because their amino acid sequences contain a characteristic CPC or CPH motif associated with a stretch of hydrophobic amino acids and N-terminal ion-binding sequences. This subfamily belongs to the P-type ATPases, a large family of integral membrane transporters that are of critical importance in all kingdoms of life. They generate and maintain (electro-) chemical gradients across cellular membranes, by translocating cations, heavy metals and lipids, and are distinguished from other main classes of transport ATPases (F- , V- , and ABC- type) by the formation of a phosphorylated (P-) intermediate state in the catalytic cycle.
Statistics
?
PSSM-Id: 319851
View PSSM: cd07553
Aligned: 4 rows
Threshold Bit Score: 856.428
Threshold Setting Gi: 32474211
Created: 12-Jan-2009
Updated: 18-Aug-2016
Structure
?
Aligned Rows:
 
Feature 1: P-type ATPase signature motif, 7 residue positions
Conserved feature residue pattern:D K [TS] G T [LIVM] [TS]Click to see conserved feature residue pattern help
Evidence:
  • Comment:a characteristic P-type ATPase conserved sequence motif: DK[TS]GT[LIVM][TS], in which D is the reversibly phosphorylated Asp

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
gi 91202858  178 AGACAGSIMLYSFAIYSGLTGP----MAQVFQYINLAFFLPVLFYCARPFYVNLWRSFRAWRPSIDLPIVLAVVIGFVLS 253
gi 198257269 122 SGAFALNGMLYTLPVYLGMDPDf--lVAPHFHWLSSIFASLSMVFCGSYFIGKAAKAAAQGIAHLDLPISIGIVFAYLVS 199
gi 150025225 175 AFFCFGNIMLLSFPEYFEVTEYwldqYRGFFRWLIFALSLPSFLYSASGYYISAYKSVKSGMLNIDIPIALGIIIFFIRS 254
gi 32474211  204 AGFCAANAMWIAIALYAGEASDveaeHWSFLRWMGTGLGLAAVLLPGRTFFQGAWASIKTRTPHMDLPVALGLTVGTVAG 283
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
gi 91202858  254 LLHLIQGrq-dLYFDSLSVLIFLLLASRYLLNRTQQKflnsscllsfFEAQICRRWNEg--rHAYEKVSAS-HLNAGDKI 329
gi 198257269 200 WYGLWKGdenlVYFDFVSTFVFLMLVGRWLQVVAIERnrnrl-adirLEAPEVEIESG----SGSRIKTRAdQIKSGEVY 274
gi 150025225 255 TFDIVMNyg-sGFFDSLTGLVFFMLLGKMFQIKTYSFlsferdfksyFPIAITKINTD----TPDQSIPIY-DIQKGDRL 328
gi 32474211  284 VIAAITGqg-eSYFDSLAVLVFLLLIGRWIQFHQQHRaak----avdLLLRITPRHTQrilaNDQTELVLVdNLRPHDSV 358
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
gi 91202858  330 LVNEGERIPADGEMINDwVNINPSvLTGESLPQKLfKGAKIYAGTQVVSgyAEILIEHt-----tGGSRIGRILKKVEEQ 404
gi 198257269 275 WLASGQRVPVRSKLLSErASLGMDwISGESESRIVeRDGEAPSGASLENq-FSVRLEA-------AEEWSDSLLNKLSAR 346
gi 150025225 329 LIRNQELIPVDGILISTqASIDYSfVTGEAIPITKhSGDKVFAGGKQIGkaIEMEVLHsvsqsylTQLWSNDIFQKNVAQ 408
gi 32474211  359 RVMAGQSVPVDGVILVGqSSIDQSlLTGESLPVSVqEGDSVSAGTVNLQspLDIRVTSv-----gRESRIGQVMQSVEEA 433
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
gi 91202858  405 IYNKtplisLTDKAAHYFTIFILSLGMLFFLFYSVI-DIAEAVRRTLALIILACPCALAFATPLTQSLSLKKAsKKGYLI 483
gi 198257269 347 EARSlerdlVAQKWIFRYLVVAFGIAVVGGGVWLAMgDLSSGLKVFISVLVVSCPCALGIAWPFGDEIALARLkQQGVFV 426
gi 150025225 409 KHKT-----ITDKISHYFTPILLLIAFAGFTYWIFI-DANIAFNVFTSVLIVACPCALALTAPFTFGNILRILgKKKFYL 482
gi 32474211  434 AAQKtpivqLADSIGGYFVVIVTLLAIATFFAWLSD-GFGIAASHATSLLIVACPCALALATPLAIAVALGRAaKRKILI 512
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                         #######                                                        
gi 91202858  484 KNAESLEKLSRVKNVFFDKTGTITQgqfeflkwkspqsGEFVNFMPDTItl------naIYSIETHSPHPIArALVKQLE 557
gi 198257269 427 TTHSLWNRLSRVRRIVFDKTGTLTR-------------SSLTMVNPEGIdrlapgelraLSALCAQTRHPVSnTIREHLM 493
gi 150025225 483 KNALVIEQLAKVDTIVFDKTGTITTn-----------kKSNISYQGTPLsnqq---lvlIKNTLKASNHPLSrLLYDFLP 548
gi 32474211  513 RDGSSLQTLASVGTIWFDKTGTLTEgk---------prATFVEGDASAIa--------hAAAIERHCEHPIAiAIQREAS 575
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
gi 91202858  558 KVCDVKl-pVCSLKEIPGKGISgTVEDNHYKLISAlpd------------dgNDDSGIIa-----sTVAIYRNELLVAYA 619
gi 198257269 494 AKGLFRadgASEAVEQVGLGVElNASGSLWRLGKA-----------------PWACELGe------GTVFARDGRQLLDL 550
gi 150025225 549 EAEKIK---INHFEEITGKGIQaQSNAFEIKIGSA-----------------LFVIGIQensiqqtAVHIKIDTTYYGKY 608
gi 32474211  576 RRDSIVp-tNAQLGQVHVGGVSgYSDGHAVLVGSLsfmqenhvvitepvlsaCDHCTNQsa----sPSIIAIDGIASCVL 650
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
gi 91202858  620 CLGDKLRKDAKETITALKKsGIKPHIVSGDNDSTVRNVAKKLGLaddSLYAGVSPEEKSTIVNKVS----NALMVGDGVN 695
gi 198257269 551 SFEDLPLPDSNREIKELGKgGLSIAILSGDREEKARLIGDSLGLdprQVFGNLLPEEKAAWIESHEp--eATLMVGDGAN 628
gi 150025225 609 IFNNEYREGLSALFENLSI-NYQIKILSGDNEGERKTLTNLLPKg-tELVFNQKPEQKLEFIKTLQengkNVMMVGDGLN 686
gi 32474211  651 AINDPLKPNVGQFIESLKRrGWRVGILSGDHPQIVAHVSEQLNLdaaKALGGLSPEDKLQHVRDHSs--gSTVMVGDGAN 728
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
gi 91202858  696 DALAMSSCSIGIAVQGSVAASLVAADIYSAKEGVSPVLDLILLSKNTISIIKRNLVISFLYNFAGGIAALFGVISPLVAA 775
gi 198257269 629 DTLAFRSAFCAGAPANEQGIVAEKADFHYLGNGIGGIRSLLTIGEQRRKALVGLMTFAVAYNLFAIGLSLIGWVTPLVAA 708
gi 150025225 687 DAGALAQSNVGISISENVNVFSPACDAILDATQFEKLNYFLKLSKKAILTIKMSFALSLLYNLVGLSFALSGNLSPLVAA 766
gi 32474211  729 DAAALAAADVGIAVRGGAEVSLQAAPIYVASDSMTSISDLIGAARRTQALIRTAFAASLSYNLVAVALAMSGRISPLVAA 808
                        650       660
                 ....*....|....*....|...
Feature 1                               
gi 91202858  776 ILMPVSSLVILLSTVAGTKFTRK 798
gi 198257269 709 VLMPLSSIISLGIVWSALGKRSG 731
gi 150025225 767 IIMPLSTITIVSFVTLMSNFYSK 789
gi 32474211  809 ILMPISSVTVLALTLAWPIFREK 831

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap