Conserved Protein Domain Family
Peptidase_S41_CPP_like

?
cd07561: Peptidase_S41_CPP_like 
C-terminal processing peptidase-like; serine protease family S41
Bacterial protease homologs of the S41 family related to C-terminal processing peptidase (CPP). CPP-1 is believed to be important for the degradation of incorrectly synthesized proteins as well as protection from thermal and osmotic stresses. CPP is synthesized with an extension on its carboxyl-terminus and specifically recognizes a C-terminal tripeptide, but cleaves at variable distance from the C-terminus. The CPP active site consists of a serine/lysine catalytic dyad. Conservation of these residues is seen in the CPP-like proteins of this group. CPP proteins contain a PDZ domain that promotes protein-protein interactions and is important for substrate recognition however, most of CPP-like proteins only have an internal fragment or lack the PDZ domain.
Statistics
?
PSSM-Id: 143477
View PSSM: cd07561
Aligned: 33 rows
Threshold Bit Score: 167.431
Threshold Setting Gi: 196254014
Created: 26-Jun-2009
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
 
Catalytic dyad
Feature 1:Catalytic dyad [active site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
gi 120435442  37 VEQTLELEIKNFEYEAMdiWYLYKDEipeynddffanqeelnvwldefdsPESLFYDGLVYQyev------vdeFSWIVD 110
gi 160879337 535 CLKYALITEDQFNNYEIs-WYIGNVYsrlsdseqale--hykmalekneeDADLLTDIGWEYyyte----eftdASLYAD 607
gi 149185581  63 LYPDLLNTSVNKADYTTlqGYLNAVTapgqalf-----------npdglpSKTFTYITSIEEenelinsgsnagFGIRLT 131
gi 119504465  40 YDVCGEESKKAFVSSVAesWYLWYEElaevep-------------edfdtAQAYLDALTAPLapdg----rdpgFSYLTD 102
gi 149917298  38 SDCTAVEAQNQFVVDVMrqNYLWSDSvpedvd------------itayedPSDLVRELRDENd----------rWTRISD 95
gi 162448439  35 KADCSLQGHNQFLFELMkdAYLWYDGvpdldy-------------raypsPEALLVDLVTEPrd---------rWSYIST 92
gi 225089513  43 IDSCGVESQKDFVLAVAqdWYLWYDEmaevdp-------------gdyssAEQYLSALTAPLaedf----rdpgFSFLTT 105
gi 85711958   36 FASCSFADQNQRFFEYMqeDYFWNDSlpqtie------------peayddVYQLLEELRAPEd----------rYSYILT 93
gi 126647726  25 IPNPDSIEVKNAIYDALeeWYYWNQElperpe------------pkgfdsNQEYLEALKFKPld---------rFSYITT 83
gi 31789404   26 PRNCTRTSQNLFVRDVLdeYYLWYRElprlnp-------------snyatPEAYLDAARFRPld--------stFSYITS 84
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
gi 120435442 111 dyealenrfagvstgtgldyglsryctgcdevlgyvryvipntpaaeagfergmvftei---dgqqitvsnfqtllapet 187
gi 160879337 608 kalqldgtnykatnlkkliekrqtnvidqvtefieknymyyksnasydtlkn----------------slianqsekied 671
gi 149185581 132 ydtlnnrvfvveafengpsflvgfdrgteilqiggqsvsalmasggpgavv-------------------dalgpgdpgv 192
gi 119504465 103 kaaddaqgstgayvgfgfsygfdfqnrflfsdvlqggpagdanfqrgnevlaidmgagyetidelserqatiseifggne 182
gi 149917298  96 kstsdalfmegkfvglgyktqrmeddsirisfvsdnspasmagilrgdrivgaggytv----aeldegglwseaygsndp 171
gi 162448439  93 ksvddaffregqtlgfgmrwsfdqegslrlaliqpgspageaglrrgdavvaingid------veqvvsddlweelagpd 166
gi 225089513 106 eaedeanltsaafvgfgfrfaindtgaylvsdvfedapafragfvrgaqilavdagngyvtmrqyeeqgaslddifggst 185
gi 85711958   94 qdeydalfvsaeyagfgfsqqqisaervklrfvyqdspawdagmrradeiiaidgvp------vsqllangtyndalgpa 167
gi 126647726  84 iedfnnsfvgknaghgfgfafdaneklfltfvyddapagkdgwkrgweiieingkai------seykngagsydfqlgna 157
gi 31789404   85 raandafygdsqfvgvgittqmsgsemrvlqvfpespaseagmargdrifeingtsv-------telietgliggafgas 157
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
gi 120435442 188 ltfglgeigegdivstdqtitvtkatinenpvhvaktlnvDGIKVGYLMYNSFtad------ydDELNEAFAQFqadGIT 261
gi 160879337 672 isklfdsihkdndpfsfilygenykrylkyqsgktveykdVGENINYIRITSFsss------taNEFLDVVDAIentKDK 745
gi 149185581 193 trsfvirsvsgvqqnasvtkeefsldpisdrygvrvlsdgAGGQVGYINLRTFivq-----dagPQLIDAFQQFrtqGIS 267
gi 119504465 183 aglergfrvrqdqsvvevilakreldtpplatepllleraGNSPVGYLNLRSFilt------anDALSDATRLFrdaGVT 256
gi 149917298 172 gvvveleiehlatgesevltitkdwidivsipvvetfegpDDTTVGYFVMDKFvgt------thDELDAAYAQFkeaGVT 245
gi 162448439 167 eegyemsltieradaeaftvalrkawygittvvsprvlqtGSATVGYLMLTTFiep------svSELDSAFALFresQVD 240
gi 225089513 186 eglergfrlqigsetveltvakeeldvppiaaaprtidrtGLAPVGYIHLRNFtls------arPALTDAFAELadqDIT 259
gi 85711958  168 esgitrditwrtptgdeqsatitkdevatntvmgqtiwqlDGQSVGYFTLDAFinr------tgNDLNQVFNELdanNID 241
gi 126647726 158 eagitnsftfklpdgsttsrsntkaeyqsnsilhqevierGGKKIGYWVYNSFkataglsptqsKEVQESLDFFqdqNIS 237
gi 31789404  158 epgvtaqvgfqsrqgverratltkrvvtiptvsltrtfqvDGRTVGYLLFRNFvep------syGALDEAFAALreaRAT 231
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
gi 120435442 262 ELVLDLRYNGGGrVSSAVALASMITGqf-eNEVIIRTRYNSflesqfdedDKVTRFNSklnngaqvNSLNLNKVYVLATG 340
gi 160879337 746 YLIIDLIDNGGGdTNSGCDILDFLLP----DRVVCNLIYKDg--------YSDSYYSDd-------AYIAFKHIFVLTNE 806
gi 149185581 268 NIILDMRYNGGGlVSVADLLGDLMGEgl-eGQVFSETNYRPsks----anDSIELFQEq------aQQIAPMRLAIIGRG 336
gi 119504465 257 DLVIDLRYNGGGlVSVADRMLDLLGGlvatGQDSWSIVHNAk--------HSDEDFGAyfa--kfpDSMRPLRIAFITTG 326
gi 149917298 246 TVVMDLRYNGGGlISVAERSVSLLLGvnheGEEAYRFEYNDylg---pteDRTADIDRy------dNSLPTEKVIVITSG 316
gi 162448439 241 ELVLDLRYNGGGrLSVERHLASLIHRpaeaGALLDITAHNDrhv----dwDKRETFDDld-----qPPLPLSRLVVITSG 311
gi 225089513 260 DFAIDLRYNGGGlVNIADLFLDLLGGavanEEVAYRVSHNEkrg----aeNRSYVFGEr------lDSVSPIRIAFITSE 329
gi 85711958  242 RLVIDLRYNGGGlIRYANQLATQTAGtqvqGKTFIQYRFNDnna----aqNETVPFSLvd----giRQLDLDQVIVLTTG 313
gi 126647726 238 ELIIDLRYNGGGsVDVAEQIMNFLIQakdnEKLMYTNKLNSlka----nfERETLFKKq-------GGLNLSQLVFITSR 306
gi 31789404  232 ELVIDLRYNGGGlVDVAVHLGGLVAGavteGRIFATFQHNDkhs----alNEDLRFERp------tQSLNLSRLFVVTTR 301
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1           #                          #                                                 
gi 120435442 341 sSASASELIINGLAPYi--DVEHIGTKTVGKVqASVTLYDaefpytnknrinteHKYALQPlISTSVNAdgn-afpEGLI 417
gi 160879337 807 nSASCSELVTLGLKTYl-dNVTVIGRKTFGKGvGQLLFEDk------------tRGFVIFM-VNHYWNVreenimgKGIQ 872
gi 149185581 337 gTASASELVSNSMIPYlgdNIALVGTDTYGKPvGQNAFDRs------------aCDDRLRAvTFKTVNAngqgdyfGGLA 404
gi 119504465 327 gTASASELVINSLSPHi--EVVLIGEDTLGKAvGQYAFDQdrwsa-----ewstCDTRLRLiAFQIVNGegageyyNGLV 399
gi 149917298 317 rTLSASELVINALFPYv--DVTLVGSTTGGKPvGSRSYEFc-------------EKLLYPV-SFRLVNAdgqsdyfDGLS 380
gi 162448439 312 gTASASESLINSLRAYm--DVKIVGSTTHGKPvGMYGWDNc-------------DMVVHPI-AFRVLNAkeegdfyDGLP 375
gi 225089513 330 sTASASELLINSLEPFv--EVVLVGSDTSGKAvGQYAFDQt------------gCDTRLRLvSFESASGegfggyyTGLV 395
gi 85711958  314 aSCSSSELVINSLRPHv--DVITIGETSCGKPvGQQPQELc-------------DKVTFAI-NFETVNSegqgqyyDGLS 377
gi 126647726 307 gSASASELVINSLNPYf--DITLIGDNTYGKPvGSFPLSNynnt-------lksNNVELVPiTFATANAegnaeyfDGFE 377
gi 31789404  302 aSASASELLINSLRPHi--PVFVIGDATYGKP-VGQYGFAf-------------CDKVLAPvAFALVNSdgqgdffGGIA 365
                        410       420
                 ....*....|....*....|...
Feature 1                               
gi 120435442 418 PDIEQQEfi---stYGTLGDPSE 437
gi 160879337 873 PDIEVLGds----nELYMNEVYN 891
gi 149185581 405 SVMPNTCiag-ddiSNQLGDPNE 426
gi 119504465 400 SSGGFTLcparddlTRNFGDPAE 422
gi 149917298 381 PDCEAADd-----vFHFLGDPEE 398
gi 162448439 376 PDCAADDt-----lGAELGDAGE 393
gi 225089513 396 DTGRFTLcalednyRGAFGSTDD 418
gi 85711958  378 PDCPVNDa-----iVADWGEFAD 395
gi 126647726 378 PDFLVGDs-----pQFNWGDPND 395
gi 31789404  366 PTCAAPDd-----lEHDLGAADE 383

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap