1N6E


Conserved Protein Domain Family
Peptidase_S41_TRI

?
cd07562: Peptidase_S41_TRI 
Click on image for an interactive view with Cn3D
Tricorn protease; serine protease family S41
The tricorn protease (TRI), a member of the S41 peptidase family and named for its tricorn-like shape, exists only in some archaea and eubacteria. It has been shown to act as a carboxypeptidase, involved in the degradation of proteasomal products to preferentially yield di- and tripeptides, with subsequent and final degradations to free amino acid residues by tricorn interacting factors, F1, F2 and F3. Tricorn is a hexameric D3-symmetric protease of 720kD, and can self-associate further into a giant icosahedral capsid structure containing twenty copies of the complex. Each tricorn peptidase monomer consists of five structural domains: a six-bladed beta-propeller and a seven-bladed beta-propeller that limit access to the active site, the two domains (C1 and C2) that carry the active site residues, and a PDZ-like domain (proposed to be important for substrate recognition) between the C1 and C2 domains. The active site tetrad residues are distributed between the C1 and C2 domains, with serine and histidine on C1 and serine and glutamate on C2.
Statistics
?
PSSM-Id: 143478
View PSSM: cd07562
Aligned: 79 rows
Threshold Bit Score: 117.301
Threshold Setting Gi: 226357161
Created: 24-Aug-2008
Updated: 17-Jan-2013
Structure
?
Program:
Drawing:
Aligned Rows:
 
Conserved site includes 4 residues -Click on image for an interactive view with Cn3D
Feature 1:Active site tetrad [active site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                       ##                
1N6E_I        685 EFLQMYDEAWKLARDNYWNea-vAKEISERIYEKYRNLVplc-ktRYDLSNVIVEMQGEYrtSHSYEMGgtftdkdpfrs 762
gi 88711162   353 FRLLTLFKYWNIVNYFSPNkh-lTDKNWDEVLTEYIPKFids-knELEYELTTLKLIGEIsdSHARIGLggqkindlrgn 430
gi 116619979   27 ANVEAFEKVWSTIRDKHWDpk-lGGVDWQATHDELRPKVeaa-ksDAAVREILNEMVGRLkqTHFGIFPgdvyhdldasg 104
gi 116620719  352 FQMLALFRYWNIIEYWFPNrd-iIGENWDDVLKQTLPKIvla-kdRDTYQLEMMALIARIhdSHANLWSslalrppvgac 429
gi 127514729  349 FRLLALYRYWNIVQYFFPYky-lTDKEWSGVLAEYLPLFlga-knRLDYEKVTLSLIAELkdTHANLWAgrgevekmrge 426
gi 149178016  223 VGAEIFDKVWNAFDREYAMfvikPEVDWQKLRDQFRPQAvla-knNRELANVLSEMLAHLkdLHVYVQVdgtyvkgfnr- 300
gi 149919766   65 AHVPAFDEVWKTVANKHFDpt-lGCLDWPALRETYGAKVaeagddTAAAYAAINELLGLLgqSHLAATPpaadpidatpq 143
gi 163755089  354 FRLLTLYRYWNMIHYYFPYky-lTDKDWSTVLKEYIPTFina-stELEYEIAALRLIGDIqdTHAGLWGgndkfqailgs 431
gi 226226479   41 AFIDQFDALWTRFDDVYPSfa-yKRVDWNAQRARYRPRAera-rsQDELVAVLIEMLAPLhdRHVWLVDprgqavptyra 118
gi 226226508   71 NPVATFDTAWSIIRRTHWDtt-yNGVNWLALREELRPRAaaa-htRGELRLVLSEMVGRLrqSHFAIIPqeladndrsad 148
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                         
1N6E_I        763 griacdfkldgdhyvvakayagdysnegekspifeygidptg---------------------------------ylied 809
gi 88711162   431 yyppfevrfiqgklvvtnyhnpelikesgleigdvithiqerave---------------------------svidslkp 483
gi 116619979  105 ehdsgdadigidlrvidgralvtevypaspagakgvkpgwailrigahdv------------------apvvsrireqfa 166
gi 116620719  430 qlpvnlrfvenqavvtgysaeamentsglkvgdviadldgvpvak----------------------------lvqtwtp 481
gi 127514729  427 fyppvftrfvegelvvvdfytdnesnisdmsrlgglsigdviteidgv---------------------aveklvkdklr 485
gi 149178016      --------------------------------------------------------------------------------
gi 149919766  144 gpavvpiavrwlpvepkseeravvivdaeldghdsglprgavltrigdepvatitervsarihehggsqaevaftiarsv 223
gi 163755089  432 ntapfkvafvenklvvtkyynpeykevskvkigdvithingktv-----------------------------eeikker 482
gi 226226479  119 n------------------------------------------------------------------------------- 119
gi 226226508  149 tttagqparggggslgwrfryldgamvltgvdsggpawaagvragwtvqavd--------------gcplaprlaalpdd 214
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                         
1N6E_I        810 idgetvgagsniyrvlsekagtsarirlsgkggdkrdlmidildddrfIRYRSWVEANRRYVHERSk------------- 876
gi 88711162   484 yypasndaarmrdisldilrsreknlsigyisedkkiqeviklfpkdsLDIVRWDVSDGKPSHKFId------------- 550
gi 116619979  167 dsslldlrlnravvtrlqgsegsavmvefldgsnrkiavdlvraaprgKLARLGNLPPTPTWSEWRrl------------ 234
gi 116620719  482 yyaasneptrlrdiarsmtrgecgaaklrvfrgtqevtlqsdrvplgsLKFSSSHDRPGETYQRLS-------------- 547
gi 127514729  486 yypasneasrlrdiapdllrsnkaeidisfrrdklmgntslklfkkdeLDYFYLYRKPKGEKSYKNi------------- 552
gi 149178016  301 ---------------------------------------erqfnaspaAAAHLIGKINQVKGMRWGrt------------ 329
gi 149919766  224 gvmlgcpengtksltftadgeertvdapcfvpegerislgnlrdlptrVSWRMVGESSPSPAPDEGgeagetggppepap 303
gi 163755089  483 hdyhpasneptkdrnmaksmlrspnkeiaityvsdgktqqhtlplygfRDLNIYAKSNKASYKLLD-------------- 548
gi 226226479  120 -------------------------------------altnfdrarweAAMRDASIVRRNEIGEGLv------------- 149
gi 226226508  215 pdprhvalrafqlasrlldggegdriavsltdgkhrlqthtltfaaapGTVTKFGNLPPMVAHLEWervr---------- 284
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                         
1N6E_I        877 -------GTIGYIHIpdm----gmMGLNEFYRLFINess-yqGLIVDVRF--NGGGf-------VSQLIIEKLMnk---- 931
gi 88711162   551 -------DNIGYITLrsl----ekKDIENIKTKFRNt----kGIIIDIRNypNTFVpy-----sLGPYFVSSTRpfv--- 607
gi 116619979  235 ------pQDIGYVRFnif---ldpDGLAKTMEEAMKgcrdcrGFVLDLRG--NPGGiggl-amgVAGWFTDKSGqq---- 298
gi 116620719  548 -------SEVAYIKMssi----knVDIPRYIDSAAGt----kGLIIDIRN--YPSDfvv---ftLGQLLVTEKTefv--- 604
gi 127514729  553 ------dGDIGYVTLati----ekEDVDSIKNQFKDa----aGIIIDIRNypNTPSmy-----sLGSFFVEDKSaf---- 609
gi 149178016  330 ------eDDIGYIAVdslsketllNQFESALKQMQGt----rGLVLDIRA--NGGGaepl-gqkMAGYFLDQPCl----- 391
gi 149919766  304 apdsnsnAKIGYLAFnywm-lpmvERIREGIKQMRAsg--meALILDLRG--NPGGvgam-svpVARLFVDRPVs----- 372
gi 163755089  549 -------NNIGYVTLeti----svDDISKIKKQFKKt----kGIIIDIRN--YPAEsil---yyLGSYFVSEPTefv--- 605
gi 226226479  150 -------GGYAYLYIgtwrapvdiDALDLALERARDa----qGLIIDLRT--NAGGsd-----gTAMAFAGRFTrra--- 208
gi 226226508  285 ----qggRTVGVIRFntwm-pvlsAQFDAAIDSLRSa----dAIVLDVRG--NLGGvggmsmgfAGHFVDTVLTlgtmhq 353
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                 #                       
1N6E_I        932 ----riGYDNPRr----------GTLSPYPtns---------vrGKIIAITNEyagSDGDIFSFSFKKlgLGKLIGT-RT 987
gi 88711162   608 ---kltAANIDNpge-----icfVKELEVPksnd-------aysGKLIVLVNEysqSQSEFTCMALRVgdNTTIVGS-TT 671
gi 116619979  299 -----lGTEYLRgm--------tLKFVIFPrpr--------pflGPLAVLVDGcsaSTSEILAGGLKDigRARLFGT-RT 356
gi 116620719  605 ---rftSGDLANpgafh-wgpplALNPQKPhy-----------aGKVVILVDEvsqSNAEYTTMAFRSatGATVIGS-TT 668
gi 127514729  610 -----aKFTYPNinnpg-efgvgNVAVLKPsev--------tfkGKLVVLVNEntqSQAEFTAMAFRAgrDTTIIGS-KT 674
gi 149178016  392 -----yATHQYRsgpkhddlgsmQKRRLIPsqdw-------yyrGPVIVLQGEktmSSAEAFALMLAEcpTVTTMGD-RT 458
gi 149919766  373 -----lGRLQMRdfn------qeFKVDANPda----------faGPIVVLVDEgtaSTSEIFALGMADvgRVTVIGAgPS 431
gi 163755089  606 ----kfSRMNEKn---------pGEFVMTEayeisk--srsmykGKLVVLVNEasqSHAEFTAMAFRAgeNTTIVGS-TT 669
gi 226226479  209 ---fpaSYVEIRtd-------prVTDVEMPlartiaprgpwqftRPVVLITGRgglSATESFAAAMRTlpQVTVIGD-TT 277
gi 226226508  354 rgatlrMVTNPRrv-------dtRARAVKPf------------aGPLALVVDElsaSTTEIFAGGLQGhrRATVFGT-RT 413
                         410       420       430       440       450       460       470
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
Feature 1                                             #                                   
1N6E_I        988 WGGVVgITPKRRLiDGTVLTQPe-FAFWFRDagfgvENYGVDPD-VEIEYAPhdylsGKDPQIDYAIDALIE 1057
gi 88711162   672 AGADG-NVSSISLpGGISTRISg-MGIYYPDgt-etQRVGIEPD-VESKPTIqgiknGRDEVLEKAIELINE 739
gi 116619979  357 AAAAL-PSVIDRLpNGDGFQYA--IANYISQggkplEGLGAIPD-QEVRLTReqllqGKDPALDAAVTWIQE 424
gi 116620719  669 AGADG-NVSQIPL-PGGLSTMIsgIGVFYPDkr-ptQRVGIVPD-IEVKPTIagilaGRDELLEAAIAEILK 736
gi 127514729  675 SGADG-NMVRLDL-PGGLRTAFsgLGVYYPDgg-etQRVGIIPD-IEVRPTIvgvreGRDELVETAIEVIKT 742
gi 149178016  459 AGSSG-NPRRIDAgAGIIVNLPr-WIAYDAAgk-pfDTVGVQPD-IRVKTTPpdftkSSDPVLSAALQRLRN 526
gi 149919766  432 AGMAL-PSLIETLpDGGLIQYV--VGDYHSTkgtaaEGEGVPLD-ARVEESRvdyaaGRDPVYDAAVAHLEA 499
gi 163755089  670 AGADG-NVSTIMLpGGLRTSISg-IGVYYPDgg-etQRIGIVPD-VEVKPTIkgikeGKDEVLEKAIEIILK 737
gi 226226479  278 GGASG-NPATFALgNGWQFTVPr-WLEYGPDrq-piEGRGVAPH-LAMAWDPasydsMRDPLIDAAVGLLGE 345
gi 226226508  414 AGQAL-PSVPERLpNGDILYHA--IADFVGPtgtpvEGAGVLPDhVTPPTARal-veGRDPALQAALHWAAT 481

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap