1UF8,1FO6,1FO6


Conserved Protein Domain Family
DCase

?
cd07569: DCase 
Click on image for an interactive view with Cn3D
N-carbamyl-D-amino acid amidohydrolase (DCase, class 6 nitrilases)
DCase hydrolyses N-carbamyl-D-amino acids to produce D-amino acids. It is an important biocatalyst in the pharmaceutical industry, producing useful D-amino acids for example in the preparation of beta-lactam antibiotics. This subgroup belongs to a larger nitrilase superfamily comprised of nitrile- or amide-hydrolyzing enzymes and amide-condensing enzymes, which depend on a Glu-Lys-Cys catalytic triad. This superfamily has been classified in the literature based on global and structure based sequence analysis into thirteen different enzyme classes (referred to as 1-13), this subgroup corresponds to class 6. Members of this superfamily generally form homomeric complexes, the basic building block of which is a homodimer. Agrobacterium radiobacter DCase forms a tetramer (dimer of dimers). Some DCases may form trimers.
Statistics
?
PSSM-Id: 143593
View PSSM: cd07569
Aligned: 20 rows
Threshold Bit Score: 470.638
Threshold Setting Gi: 151413397
Created: 21-Apr-2009
Updated: 17-Jan-2013
Structure
?
Program:
Drawing:
Aligned Rows:
 
Conserved site includes 15 residues -Click on image for an interactive view with Cn3D
Feature 1:active site [active site]
Evidence:
  • Structure:1UF8_A, Agrobacterium sp., DCase (C171aV236A mutant) dimer bound with N-carbamyl-D-phenylalanine; contacts defined at 4A.
    View structure with Cn3D
  • Comment:Agrobacterium radiobacter DCase is a tetramer (dimer of dimers) having four active sites, two per dimer. All but one of the active site residues comes from one of the two participating monomers; the remaining residue comes from the it#s partner monomer.

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                     #     #                            
1UF8_A         1 TRQMILAVGQQGPIARAETREQVVVRLLDMLTKAASRGANFIVFPELALTTFFPRWHFt--DEAELDSFYETe--MPGPV 76
gi 27903505    2 AKNLMLAVAQVGGIDSSESRPEVVARLIALLEEAASQGAELVVFPELTLTTFFPRTWF---EEGDFEEYFDKs--MPNDD 76
gi 163795878   2 SRIINVGAAQLGPIAPDESRVSAVNRMIDLLKQAKDRGVKLVVFPELALTTFFPRYYEq--DISKMDHHFERg-dMPTPE 78
gi 163856643   5 QRKIGLAVAQMGPVHLADTRRAVVARLVEMLREAHARGADLVVFPELALTTFFPRYWMs--DEEAQARFFEAq--MPNAE 80
gi 27378441    1 MRIVNVAAAQMGPIQKADSREAVVKRMIALMDEAKAKGADLIVYPELALTTFFPRWYVe--DRAEFDNWFERe--MPSAA 76
gi 83950315   27 ARKEIFAVAQMGPVHLADTKAQVVARLIDMLREAHGRGARWVTFPELALTTFFPRYIYd--TPEEYDQFFEEg--LPSPA 102
gi 187477183   6 SRIVTVAAAQLGPIQRAEGRESVVARMIRLLERAQQRGAQVVVFPELALTTFFPRWYCe--NRDEADGWFETs--LPSPA 81
gi 158424356   2 TRVLRLAAAQMGPTSRTEPRAVTLDRMIRLLEAAAADGAQLVVFPELAFTTFFPRWLL---DDAELLASFETa--MPNPG 76
gi 115436938   2 SRTVRIAAAQMGTTNSWDKREGTVRRMLALLNDAADKGAQVVLFPETSFTTFFPRYLIl--DEKELDAWFEHgdiRTNPN 79
gi 134113254   2 ARKITVAAAQVGAVHKDSQRPETLSRLISLLEQASQKGVEVLVYPETTFTTFFPRWKGlddDREELDRWFEHgdiTANPN 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                               #   ##            # #    
1UF8_A        77 VRPLFEKAAELGIGFNLGYAELVVEgg-----vkRRFNTSILV-DKSGKIvGKYRKIHLPGHKEYE-AYRPFQHLEKRYF 149
gi 27903505   77 VAPLFERAKDLGVGFYLGYAELTSDe--------KRYNTSILV-NKHGDIvGKYRKMHLPGHADNR-EGLPNQHLEKKYF 146
gi 163795878  79 TRPLFEKAKEFGIGFYLGYAELTEGg--------HRFNTSILV-DDTGKIvGKYRKVHLPGHSEYD-GKRPWQHLEKRYF 148
gi 163856643  81 VQPLFDEARRLGVGFYLGYAELTPEg--------VPYNTAILV-DRGARIvGKYRKVHLPGHDDHK-PQAPFQHLEKKFF 150
gi 27378441   77 TKPLFERAAQHQMAMNFGYAELTPDg--------HHFNTAILT-DKSGRIvGKYRKIHLPGHVEYD-TKRSHQHLEKRYF 146
gi 83950315  103 MQPLFEVARDLGVGFYLGYAEKTEDag-----qtRRFNTSVLV-GPDGALlGKYRKIHLPGTVDPI-GDLEFEHLEKRYF 175
gi 187477183  82 TQPLFDAIKRYGLMVYLGYAELAWEpdeqgvvrkRRFNTSVVI-APNGEIvFKYRKVHLPGQAEFA-PYRKVQHLEKRYF 159
gi 158424356  77 VQPLFDRARALGVGFYVGYAELTPAg--------QRFNSSITV-GPDGAIlGKYRKVHLPGSVEPR-PGDRFQQLEKRYF 146
gi 115436938  80 TKALFDFAHERGVDISVGFAEATDDg--------EHYNTCVYYhAATGSIlSKYRKIHLPGDVEPLpDPTAVNQLEKRYF 151
gi 134113254  82 IAPLISRAKDLGIDIVIGYGEKTDDs--------HYYNTCSYI-HAGKEI-SKYRKVHLPGNKEPYpDPEFIDQLEKRYF 151
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                      ## ##                    ##   #                   
1UF8_A       150 EPGDlGFPVYDVd---------AAKMGMFIANDRRWPEAWRVMGLRGAEIICGGYNTPTHNPP---------VPQHDHLT 211
gi 27903505  147 REGDlGFGVFDFh---------GVQVGMCLCNDRRWPEVYRSLALQGAELVVLGYNTPDFVPG---------WQEEPHAK 208
gi 163795878 149 EPGDlGFNVWRSm---------GGIMGMCICNDRRWPETYRVMSLKGVEIVMLGYNTPDVNTS---------APEPNHLR 210
gi 163856643 151 QVGDqPFGVWDTm---------GTKIGMCLCNDRRWPETWRVMSLQSAELVVLGYNTPSVNIH---------WPEPVHLR 212
gi 27378441  147 EPGDlGFKVWREl---------GGIIGMAICNDRRWPETYRVMGLQGVEMVLIGYNTPSVNAEk--------SEEGVEKR 209
gi 83950315  176 EVGDlGFPTFATp---------SGRFGMCICNDRRWPETFRVMALRGAEVFMLGYNTPTRNIH---------HPEPAHLR 237
gi 187477183 160 EVGNlGFPVVRTpva----pglEVNMGMLICNDRRWPEAWRVLGLQQVELVMVGYNTPSLNHEn-------qGFEAHHLR 228
gi 158424356 147 EYGDlGFPAFRGpqa-----wqSPILGMLVCNDRRWPEAWRAYGLQGVELMLMGYNSAAYDPNg-------gNTEDAALR 214
gi 115436938 152 KPGNlGFNAFRVpglis-egetDPIMGMMICNDRRWAESWRVLGLQGVEVVLCGYNTNGYAPQfwglsadmdPKEAEEMS 230
gi 134113254 152 EPGDyGFKAFRVpdlavtpedgEAIAGMMICNDRRWAESWRCLGLQGVELVCLGYNTSTWAPGlfghskdadPEVIKAQS 231
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                  #     
1UF8_A       212 SFHHLLSMQAGSYQNGAWSAAAGKAGMEE-NCMLLGHSCIVAPTGEIVALTTTLEDEVITAAVDLDRCRELREHIFNFKQ 290
gi 27903505  209 MFTHLLSLQAGAYQNSVFVAAAGKSGFED-GHHMIGGSAVAAPSGEILAKAAGEGDEVVVVKADIDMGKPYKESVFDFAA 287
gi 163795878 211 MFHNHLVMQASAYQNSCFVVATAKAGIED-GCMLIGGSCIIQPSGEIVSLATTVQDELITSACDLDLAKMGKETVFNFAK 289
gi 163856643 213 MHHHLITLQASAYQNCVWAAAAAKCGAED-GHHMIGGSVIVAPTGEIAAQASTEDDEVITVSADLGLAETFRRHVFDFAR 291
gi 27378441  210 LFHNRLSVQAGAYQNATWVVAVAKAGNED-GHPLFGGSLIVDPNGEIVAEAKTDDDEVLVHACDLDATTFGKTTIFDFAR 288
gi 83950315  238 EFHNRLSLESAAYQNGAWVMAAAKCGSED-GFAMIGGSAIVAPTGEVVARAVSEEDEVISYDCDLDLGAYIRRSVFDFAR 316
gi 187477183 229 VQNSQLSVQAGCYQNATFGVSVAKAGKED-GHELFGHSIIVNPQGEVIALAASWDDELVVADCNLAMCDLGRNTLFNFAK 307
gi 158424356 215 TFHSTLVAQANAYMNATWAVSVAKAGDED-GSALIGGSCIVDPNGVLVAQAKTLEDEVLVADCDLDACRQGKEKMFNFAA 293
gi 115436938 231 LFHHRLVMQCHSYTNATFSVSAARCGLDDgKYPLIAGSMIVDPEGRILAESTTVADEVIIADCDLLLCRPGKQRTFDFAR 310
gi 134113254 232 EFQHLLVMQAHSYTNATFSIAAARAGFDDgKFGLIGCSCIVHPEGHIIAQSKTMDDELVIATIDLDDAKIGKQKVFNFGL 311
                        330
                 ....*....|..
Feature 1                    
1UF8_A       291 HRQPQHYGLIAE 302
gi 27903505  288 HRRPDAYGIIAE 299
gi 163795878 290 HRRIEHYGIITS 301
gi 163856643 292 HRRPEHYRLIVE 303
gi 27378441  289 HRRIEHYGLITS 300
gi 83950315  317 HRRIEHYGPITD 328
gi 187477183 308 HRRPEAYSRIVE 319
gi 158424356 294 HRRPEHYRRLVD 305
gi 115436938 311 HRRVEHYGRILS 322
gi 134113254 312 HRQPHQYSIITQ 323

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap